Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GJ39

Protein Details
Accession A0A1Y2GJ39    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAESRKKKRFNPDKSDVRLYEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035899  DBL_dom_sf  
IPR000219  DH-domain  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
Pfam View protein in Pfam  
PF00621  RhoGEF  
PROSITE View protein in PROSITE  
PS50010  DH_2  
Amino Acid Sequences MAESRKKKRFNPDKSDVRLYERLARLLSHIKDLWNGHQSLLRSLQNKQQQETPVVQNIGSVFENFYMFSIYDSYFAQYTTTSRDFQHIITGSSELCIIIRHLLKSPRCKCLTLEGIFLKPIQRLQKYPLFFKVDIDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.76
4 0.72
5 0.66
6 0.59
7 0.58
8 0.5
9 0.45
10 0.37
11 0.35
12 0.32
13 0.35
14 0.32
15 0.29
16 0.27
17 0.26
18 0.29
19 0.31
20 0.32
21 0.29
22 0.29
23 0.24
24 0.26
25 0.26
26 0.25
27 0.28
28 0.26
29 0.23
30 0.25
31 0.31
32 0.36
33 0.38
34 0.36
35 0.36
36 0.34
37 0.36
38 0.38
39 0.33
40 0.29
41 0.27
42 0.25
43 0.21
44 0.19
45 0.18
46 0.14
47 0.11
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.11
67 0.14
68 0.14
69 0.15
70 0.17
71 0.18
72 0.18
73 0.23
74 0.19
75 0.18
76 0.17
77 0.17
78 0.15
79 0.14
80 0.14
81 0.08
82 0.07
83 0.06
84 0.06
85 0.1
86 0.12
87 0.13
88 0.17
89 0.25
90 0.31
91 0.41
92 0.46
93 0.51
94 0.52
95 0.52
96 0.5
97 0.52
98 0.54
99 0.46
100 0.47
101 0.41
102 0.39
103 0.39
104 0.37
105 0.3
106 0.23
107 0.27
108 0.28
109 0.3
110 0.32
111 0.38
112 0.45
113 0.47
114 0.51
115 0.53
116 0.52
117 0.48