Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G6T8

Protein Details
Accession A0A1Y2G6T8    Localization Confidence High Confidence Score 19.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-82NEGLEPRKRGRPRKKPLDSQTPVBasic
85-106LYPPAEPRKRGRPRKNPVDSPMHydrophilic
123-147ESIPPGEPRKRGRPKKEGQEPLTAPBasic
NLS Segment(s)
PositionSequence
65-99PRKRGRPRKKPLDSQTPVKALYPPAEPRKRGRPRK
129-139EPRKRGRPKKE
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MTSRENGTHRTAGELTATAPGSGSRVTTTASAAANGTGTGAGAGTATIPAATSSAASVTNEGLEPRKRGRPRKKPLDSQTPVKALYPPAEPRKRGRPRKNPVDSPMNASSSSSSSHAHPSNAESIPPGEPRKRGRPKKEGQEPLTAPPTTLSEAEPRKRGRPSHSLHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.18
4 0.18
5 0.13
6 0.13
7 0.12
8 0.12
9 0.11
10 0.11
11 0.08
12 0.09
13 0.1
14 0.11
15 0.12
16 0.13
17 0.13
18 0.13
19 0.12
20 0.11
21 0.1
22 0.09
23 0.08
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.1
50 0.12
51 0.15
52 0.18
53 0.27
54 0.34
55 0.45
56 0.55
57 0.62
58 0.71
59 0.79
60 0.84
61 0.85
62 0.85
63 0.86
64 0.79
65 0.74
66 0.68
67 0.59
68 0.51
69 0.42
70 0.35
71 0.25
72 0.22
73 0.2
74 0.2
75 0.27
76 0.32
77 0.34
78 0.37
79 0.47
80 0.55
81 0.63
82 0.68
83 0.7
84 0.75
85 0.84
86 0.88
87 0.83
88 0.79
89 0.77
90 0.67
91 0.63
92 0.55
93 0.46
94 0.37
95 0.31
96 0.27
97 0.19
98 0.19
99 0.14
100 0.13
101 0.12
102 0.18
103 0.2
104 0.2
105 0.19
106 0.2
107 0.24
108 0.23
109 0.22
110 0.17
111 0.17
112 0.19
113 0.23
114 0.26
115 0.24
116 0.3
117 0.37
118 0.47
119 0.56
120 0.64
121 0.7
122 0.75
123 0.81
124 0.86
125 0.9
126 0.89
127 0.82
128 0.81
129 0.74
130 0.69
131 0.65
132 0.54
133 0.44
134 0.35
135 0.33
136 0.25
137 0.24
138 0.19
139 0.22
140 0.31
141 0.37
142 0.43
143 0.45
144 0.5
145 0.56
146 0.61
147 0.6
148 0.62