Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2H2J4

Protein Details
Accession A0A1Y2H2J4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-86ILYSTLTTDKHKKRKKKKKKKKRKKBasic
NLS Segment(s)
PositionSequence
71-86KHKKRKKKKKKKKRKK
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MIFVLCISVSKRNLASLLFISCNRTAVIFEHDFLVRQTLAARTSVTATSTLQLSSSPYSIFILYSTLTTDKHKKRKKKKKKKKRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.19
4 0.2
5 0.19
6 0.19
7 0.21
8 0.2
9 0.21
10 0.18
11 0.16
12 0.14
13 0.13
14 0.19
15 0.16
16 0.16
17 0.16
18 0.16
19 0.16
20 0.16
21 0.16
22 0.09
23 0.08
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.09
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.09
37 0.08
38 0.07
39 0.07
40 0.08
41 0.09
42 0.09
43 0.08
44 0.09
45 0.1
46 0.1
47 0.1
48 0.08
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1
54 0.11
55 0.16
56 0.26
57 0.35
58 0.45
59 0.55
60 0.64
61 0.74
62 0.85
63 0.91
64 0.93
65 0.94
66 0.95