Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GNZ9

Protein Details
Accession A0A1Y2GNZ9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-37TAFYNPHEVKRRRRTSKSQFKILEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MEIENQSLHGELRTAFYNPHEVKRRRRTSKSQFKILEKAFIENPKPDASTRRHLAQRLSMSPRGIQVWFQNRRAKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.23
5 0.24
6 0.32
7 0.4
8 0.45
9 0.55
10 0.65
11 0.74
12 0.73
13 0.79
14 0.82
15 0.83
16 0.88
17 0.84
18 0.83
19 0.78
20 0.73
21 0.72
22 0.62
23 0.57
24 0.46
25 0.41
26 0.34
27 0.32
28 0.29
29 0.23
30 0.24
31 0.19
32 0.19
33 0.18
34 0.22
35 0.24
36 0.3
37 0.32
38 0.37
39 0.4
40 0.42
41 0.44
42 0.46
43 0.47
44 0.46
45 0.49
46 0.46
47 0.43
48 0.41
49 0.4
50 0.35
51 0.3
52 0.26
53 0.28
54 0.35
55 0.41
56 0.47
57 0.53