Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GCH9

Protein Details
Accession A0A1Y2GCH9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21HHGKHFRRLNRTSSHRKSMFBasic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
Amino Acid Sequences MHHGKHFRRLNRTSSHRKSMFRNLVTQLIQHDRIKTTLPKAQELKAIADQMITLGKRGDLHAKVQAASFLREHETTLPKLFGPLAERFKNRKGGYTRIHKLGNRFGDNAPVAVIELIDGPGDLKNQMLFKALARQEAIKPGSIKEIVEANLNKASSSSTKTTATETETATVTGTTVAKAAAAFKNKALARHIPKVMSSNKWELNDLEAKVRELSIQGENKIFDATTTSTKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.76
4 0.76
5 0.75
6 0.76
7 0.77
8 0.69
9 0.66
10 0.59
11 0.59
12 0.54
13 0.48
14 0.42
15 0.38
16 0.4
17 0.36
18 0.36
19 0.31
20 0.32
21 0.35
22 0.35
23 0.34
24 0.33
25 0.34
26 0.39
27 0.4
28 0.42
29 0.42
30 0.39
31 0.37
32 0.36
33 0.34
34 0.26
35 0.23
36 0.2
37 0.16
38 0.17
39 0.13
40 0.1
41 0.1
42 0.1
43 0.11
44 0.13
45 0.19
46 0.17
47 0.2
48 0.24
49 0.25
50 0.25
51 0.24
52 0.26
53 0.2
54 0.21
55 0.18
56 0.15
57 0.17
58 0.16
59 0.17
60 0.18
61 0.21
62 0.2
63 0.22
64 0.21
65 0.18
66 0.19
67 0.18
68 0.14
69 0.15
70 0.18
71 0.23
72 0.27
73 0.32
74 0.35
75 0.39
76 0.46
77 0.43
78 0.45
79 0.43
80 0.46
81 0.5
82 0.56
83 0.56
84 0.52
85 0.56
86 0.5
87 0.49
88 0.48
89 0.47
90 0.39
91 0.37
92 0.33
93 0.32
94 0.31
95 0.27
96 0.19
97 0.13
98 0.1
99 0.08
100 0.07
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.07
114 0.08
115 0.08
116 0.09
117 0.16
118 0.17
119 0.17
120 0.18
121 0.19
122 0.19
123 0.24
124 0.25
125 0.19
126 0.19
127 0.18
128 0.21
129 0.2
130 0.19
131 0.14
132 0.15
133 0.13
134 0.18
135 0.18
136 0.17
137 0.19
138 0.19
139 0.17
140 0.15
141 0.16
142 0.13
143 0.17
144 0.17
145 0.18
146 0.2
147 0.21
148 0.23
149 0.23
150 0.24
151 0.22
152 0.21
153 0.19
154 0.18
155 0.18
156 0.16
157 0.14
158 0.1
159 0.09
160 0.09
161 0.07
162 0.07
163 0.07
164 0.07
165 0.07
166 0.11
167 0.13
168 0.18
169 0.18
170 0.19
171 0.27
172 0.27
173 0.3
174 0.31
175 0.36
176 0.39
177 0.46
178 0.49
179 0.43
180 0.43
181 0.48
182 0.48
183 0.45
184 0.43
185 0.43
186 0.45
187 0.45
188 0.45
189 0.39
190 0.39
191 0.39
192 0.35
193 0.34
194 0.3
195 0.3
196 0.28
197 0.28
198 0.23
199 0.18
200 0.2
201 0.22
202 0.25
203 0.26
204 0.28
205 0.28
206 0.28
207 0.28
208 0.24
209 0.17
210 0.16
211 0.17