Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GHD7

Protein Details
Accession A0A1Y2GHD7   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-95AVSAADQKRKRKRREMQPVNKIVEHydrophilic
NLS Segment(s)
PositionSequence
79-85KRKRKRR
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003657  WRKY_dom  
IPR036576  WRKY_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF03106  WRKY  
PROSITE View protein in PROSITE  
PS50811  WRKY  
Amino Acid Sequences MATVSGNGPYTSQPPQQGSQHNQPGTSSSILSSLHGTGSVVSMGISGLGHGTTVRNVPTSAAGLSGSTTSAAVSAADQKRKRKRREMQPVNKIVESPDPHIDQYLWKNNGNTLRRKTGCKSIYYKCSNSAGGCTVNKTVKKKKAAGTLQSKRRTSGGLHQIQTCSDGGPGGSECIQPPTRAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.42
4 0.48
5 0.52
6 0.57
7 0.62
8 0.57
9 0.54
10 0.49
11 0.45
12 0.4
13 0.34
14 0.24
15 0.15
16 0.16
17 0.16
18 0.16
19 0.16
20 0.12
21 0.11
22 0.11
23 0.1
24 0.08
25 0.08
26 0.07
27 0.06
28 0.05
29 0.05
30 0.04
31 0.05
32 0.04
33 0.03
34 0.04
35 0.03
36 0.04
37 0.04
38 0.05
39 0.06
40 0.07
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.11
47 0.1
48 0.09
49 0.08
50 0.07
51 0.08
52 0.07
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.12
62 0.15
63 0.22
64 0.26
65 0.35
66 0.46
67 0.55
68 0.63
69 0.65
70 0.72
71 0.76
72 0.84
73 0.87
74 0.87
75 0.87
76 0.86
77 0.78
78 0.68
79 0.57
80 0.46
81 0.4
82 0.32
83 0.25
84 0.21
85 0.2
86 0.19
87 0.2
88 0.19
89 0.17
90 0.21
91 0.26
92 0.26
93 0.26
94 0.26
95 0.29
96 0.37
97 0.39
98 0.41
99 0.37
100 0.44
101 0.45
102 0.49
103 0.49
104 0.51
105 0.5
106 0.48
107 0.5
108 0.48
109 0.55
110 0.56
111 0.55
112 0.48
113 0.48
114 0.44
115 0.38
116 0.33
117 0.26
118 0.24
119 0.23
120 0.22
121 0.23
122 0.26
123 0.31
124 0.37
125 0.44
126 0.48
127 0.55
128 0.59
129 0.62
130 0.67
131 0.7
132 0.72
133 0.73
134 0.75
135 0.77
136 0.79
137 0.73
138 0.65
139 0.58
140 0.51
141 0.44
142 0.44
143 0.45
144 0.45
145 0.46
146 0.47
147 0.47
148 0.45
149 0.43
150 0.33
151 0.23
152 0.15
153 0.13
154 0.1
155 0.11
156 0.11
157 0.11
158 0.13
159 0.13
160 0.14
161 0.2
162 0.22
163 0.21