Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C187

Protein Details
Accession A0A1Y2C187    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
110-130VGGGKVKEKRRNKAIEPRVPQBasic
NLS Segment(s)
PositionSequence
114-127KVKEKRRNKAIEPR
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 4.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MDPTFVPEDRTDPLYEIEKVVSVTRRNGMFYYLVKFKGQKANQNREYNDDTLSAETRRIFWEKQKADGGPIYKSFKRHVDAYYRDDPLLPPAVDLEDVAVILPAKVNVAVGGGKVKEKRRNKAIEPRVPQEGTRTSGRLADKRAARQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.19
5 0.18
6 0.17
7 0.19
8 0.22
9 0.21
10 0.23
11 0.27
12 0.28
13 0.29
14 0.28
15 0.27
16 0.25
17 0.25
18 0.26
19 0.25
20 0.26
21 0.26
22 0.27
23 0.29
24 0.36
25 0.38
26 0.42
27 0.48
28 0.57
29 0.64
30 0.7
31 0.66
32 0.62
33 0.63
34 0.55
35 0.46
36 0.36
37 0.28
38 0.22
39 0.22
40 0.16
41 0.14
42 0.13
43 0.13
44 0.14
45 0.17
46 0.17
47 0.22
48 0.32
49 0.31
50 0.35
51 0.37
52 0.35
53 0.33
54 0.35
55 0.3
56 0.22
57 0.24
58 0.24
59 0.22
60 0.24
61 0.24
62 0.25
63 0.26
64 0.27
65 0.27
66 0.3
67 0.33
68 0.38
69 0.4
70 0.37
71 0.35
72 0.33
73 0.3
74 0.24
75 0.24
76 0.17
77 0.12
78 0.11
79 0.12
80 0.11
81 0.11
82 0.09
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.05
98 0.08
99 0.09
100 0.13
101 0.18
102 0.26
103 0.35
104 0.43
105 0.52
106 0.59
107 0.67
108 0.72
109 0.77
110 0.8
111 0.81
112 0.8
113 0.75
114 0.73
115 0.65
116 0.57
117 0.53
118 0.47
119 0.41
120 0.38
121 0.35
122 0.29
123 0.33
124 0.39
125 0.38
126 0.38
127 0.42
128 0.45