Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P823

Protein Details
Accession G9P823   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-37SQSGRSSRHHTTSRRHSHKKRRSRSDRGSGFFGBasic
NLS Segment(s)
PositionSequence
17-29SRRHSHKKRRSRS
Subcellular Location(s) nucl 11, mito 6, cyto_nucl 6, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences GDAVSQSGRSSRHHTTSRRHSHKKRRSRSDRGSGFFGGEGSSYRKNNGSRGSFFGLGGNNSRSSLFGNRRPSYYKRSPREGFLQRCLKQLKRLLRDLQHYAKRHPWKVFFLVIVPLVTGGALTALLARFGLRIPPSIERMLGVAKRAATGDPFTAVNDAVRMAGEYGNGNGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.69
4 0.76
5 0.8
6 0.84
7 0.86
8 0.9
9 0.93
10 0.94
11 0.93
12 0.93
13 0.93
14 0.93
15 0.93
16 0.92
17 0.9
18 0.83
19 0.77
20 0.67
21 0.57
22 0.46
23 0.36
24 0.25
25 0.16
26 0.14
27 0.13
28 0.17
29 0.17
30 0.18
31 0.23
32 0.25
33 0.3
34 0.36
35 0.38
36 0.36
37 0.4
38 0.42
39 0.38
40 0.36
41 0.33
42 0.26
43 0.22
44 0.22
45 0.18
46 0.14
47 0.14
48 0.14
49 0.12
50 0.13
51 0.2
52 0.23
53 0.28
54 0.37
55 0.37
56 0.39
57 0.44
58 0.46
59 0.47
60 0.52
61 0.55
62 0.52
63 0.6
64 0.59
65 0.58
66 0.62
67 0.63
68 0.56
69 0.55
70 0.58
71 0.5
72 0.54
73 0.54
74 0.47
75 0.44
76 0.47
77 0.47
78 0.43
79 0.47
80 0.47
81 0.48
82 0.52
83 0.51
84 0.52
85 0.51
86 0.48
87 0.46
88 0.5
89 0.52
90 0.53
91 0.52
92 0.48
93 0.45
94 0.47
95 0.45
96 0.37
97 0.3
98 0.26
99 0.22
100 0.18
101 0.13
102 0.09
103 0.07
104 0.06
105 0.05
106 0.03
107 0.02
108 0.02
109 0.02
110 0.03
111 0.04
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.09
118 0.09
119 0.12
120 0.15
121 0.18
122 0.22
123 0.23
124 0.23
125 0.19
126 0.2
127 0.23
128 0.21
129 0.19
130 0.18
131 0.17
132 0.18
133 0.18
134 0.18
135 0.15
136 0.16
137 0.15
138 0.15
139 0.15
140 0.15
141 0.15
142 0.15
143 0.13
144 0.11
145 0.1
146 0.09
147 0.08
148 0.08
149 0.08
150 0.09
151 0.09
152 0.1