Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P7H4

Protein Details
Accession G9P7H4   
Localization Confidence High
Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-32IPTSADPRSKRPTKKRALTPGSAQHydrophilic
118-152KTEKDRKDEERTRKNREKRDKAKARKAKKGKGGGGBasic
NLS Segment(s)
PositionSequence
18-23KRPTKK
117-150GKTEKDRKDEERTRKNREKRDKAKARKAKKGKGG
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSAEGPESIPTSADPRSKRPTKKRALTPGSAQAASLDALFAKPDQEIRVPPPASSLEGGRRRPPPPEIVSNVQGSSAGAGSGEFHVYKAARRREYERLREMDEEVKRERDQVDFEKGKTEKDRKDEERTRKNREKRDKAKARKAKKGKGGGGNDDNAKDTDGNGSKTSAVATPNGGSQENEKLSKDENGTERNGTEKPASEPVGLVIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.43
4 0.52
5 0.62
6 0.7
7 0.75
8 0.79
9 0.86
10 0.88
11 0.89
12 0.88
13 0.83
14 0.78
15 0.76
16 0.7
17 0.6
18 0.49
19 0.39
20 0.32
21 0.26
22 0.2
23 0.11
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.06
30 0.08
31 0.11
32 0.13
33 0.16
34 0.19
35 0.28
36 0.28
37 0.27
38 0.28
39 0.27
40 0.26
41 0.24
42 0.23
43 0.24
44 0.31
45 0.34
46 0.37
47 0.41
48 0.4
49 0.43
50 0.44
51 0.42
52 0.4
53 0.44
54 0.43
55 0.43
56 0.44
57 0.42
58 0.38
59 0.3
60 0.25
61 0.18
62 0.13
63 0.09
64 0.05
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.05
71 0.05
72 0.07
73 0.08
74 0.11
75 0.19
76 0.25
77 0.28
78 0.31
79 0.36
80 0.45
81 0.53
82 0.58
83 0.56
84 0.52
85 0.51
86 0.49
87 0.46
88 0.42
89 0.36
90 0.31
91 0.26
92 0.26
93 0.23
94 0.24
95 0.23
96 0.17
97 0.19
98 0.19
99 0.26
100 0.25
101 0.25
102 0.3
103 0.3
104 0.31
105 0.35
106 0.39
107 0.35
108 0.4
109 0.48
110 0.47
111 0.57
112 0.63
113 0.66
114 0.7
115 0.73
116 0.77
117 0.78
118 0.81
119 0.82
120 0.84
121 0.85
122 0.83
123 0.87
124 0.88
125 0.89
126 0.91
127 0.9
128 0.88
129 0.87
130 0.88
131 0.85
132 0.83
133 0.82
134 0.78
135 0.77
136 0.73
137 0.69
138 0.63
139 0.58
140 0.51
141 0.42
142 0.36
143 0.28
144 0.24
145 0.16
146 0.13
147 0.17
148 0.18
149 0.2
150 0.2
151 0.2
152 0.19
153 0.19
154 0.2
155 0.15
156 0.13
157 0.12
158 0.13
159 0.13
160 0.14
161 0.16
162 0.16
163 0.15
164 0.16
165 0.23
166 0.24
167 0.26
168 0.25
169 0.25
170 0.27
171 0.31
172 0.31
173 0.3
174 0.31
175 0.33
176 0.35
177 0.36
178 0.34
179 0.33
180 0.31
181 0.28
182 0.25
183 0.24
184 0.25
185 0.3
186 0.32
187 0.29
188 0.28
189 0.27
190 0.28
191 0.25