Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C7C1

Protein Details
Accession A0A1Y2C7C1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-45LPVEGVKKRLRKKTRPSPSVGHydrophilic
NLS Segment(s)
PositionSequence
31-39KKRLRKKTR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MAQYLSSDKSYSNHLMLWYAKEAELPVEGVKKRLRKKTRPSPSVGVVKSDNSLTNLTTFRLRRVASYLRAVPVNLRHQYLLKLMVRVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.24
4 0.26
5 0.22
6 0.19
7 0.18
8 0.17
9 0.16
10 0.14
11 0.13
12 0.11
13 0.09
14 0.14
15 0.14
16 0.17
17 0.22
18 0.29
19 0.36
20 0.45
21 0.54
22 0.59
23 0.69
24 0.76
25 0.83
26 0.8
27 0.79
28 0.73
29 0.69
30 0.67
31 0.57
32 0.48
33 0.38
34 0.33
35 0.28
36 0.24
37 0.19
38 0.13
39 0.13
40 0.11
41 0.12
42 0.12
43 0.13
44 0.18
45 0.18
46 0.18
47 0.23
48 0.23
49 0.22
50 0.28
51 0.32
52 0.31
53 0.36
54 0.36
55 0.33
56 0.34
57 0.33
58 0.31
59 0.32
60 0.36
61 0.33
62 0.32
63 0.32
64 0.32
65 0.35
66 0.34
67 0.35
68 0.29