Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B0S3

Protein Details
Accession A0A1Y2B0S3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-107GAKGIISSKQRKERKNRAKKFRGTKKAKAATAGHydrophilic
NLS Segment(s)
PositionSequence
68-109RLIRHGIGAKGIISSKQRKERKNRAKKFRGTKKAKAATAGKK
Subcellular Location(s) mito 15, cyto 7.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MIVDVIHPGRPNVSHKELGEKLAKLYGSTEECVFTFGFRTAFGGGKSTGFALIYDSLEDAKKVEPKYRLIRHGIGAKGIISSKQRKERKNRAKKFRGTKKAKAATAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.44
4 0.43
5 0.44
6 0.44
7 0.37
8 0.32
9 0.3
10 0.3
11 0.21
12 0.21
13 0.21
14 0.18
15 0.19
16 0.18
17 0.16
18 0.16
19 0.17
20 0.16
21 0.11
22 0.1
23 0.1
24 0.09
25 0.08
26 0.1
27 0.1
28 0.11
29 0.11
30 0.11
31 0.1
32 0.1
33 0.11
34 0.09
35 0.08
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.12
49 0.13
50 0.18
51 0.21
52 0.27
53 0.37
54 0.42
55 0.46
56 0.46
57 0.47
58 0.46
59 0.49
60 0.43
61 0.34
62 0.29
63 0.24
64 0.2
65 0.18
66 0.17
67 0.17
68 0.24
69 0.31
70 0.41
71 0.49
72 0.56
73 0.67
74 0.75
75 0.81
76 0.85
77 0.88
78 0.89
79 0.91
80 0.93
81 0.93
82 0.93
83 0.93
84 0.9
85 0.9
86 0.89
87 0.88
88 0.8
89 0.77