Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C3W5

Protein Details
Accession A0A1Y2C3W5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-32PSTPIQSPPTRKKPGRKPLGLSHydrophilic
NLS Segment(s)
PositionSequence
21-54RKKPGRKPLGLSAEDRVRMNREAQRLSRERKNKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MEPEQVFVAIPSTPIQSPPTRKKPGRKPLGLSAEDRVRMNREAQRLSRERKNKRLAAAEEENEALRLRVQQLEAQLTSHSEPTSAYCRNCEFNHTELNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.17
3 0.23
4 0.32
5 0.41
6 0.5
7 0.58
8 0.64
9 0.73
10 0.8
11 0.84
12 0.85
13 0.81
14 0.77
15 0.77
16 0.78
17 0.7
18 0.61
19 0.55
20 0.48
21 0.43
22 0.38
23 0.3
24 0.24
25 0.23
26 0.26
27 0.26
28 0.27
29 0.29
30 0.31
31 0.37
32 0.4
33 0.44
34 0.47
35 0.52
36 0.55
37 0.6
38 0.66
39 0.62
40 0.6
41 0.62
42 0.56
43 0.55
44 0.52
45 0.43
46 0.36
47 0.33
48 0.29
49 0.22
50 0.19
51 0.12
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.13
58 0.16
59 0.19
60 0.19
61 0.18
62 0.17
63 0.17
64 0.17
65 0.17
66 0.14
67 0.11
68 0.11
69 0.14
70 0.2
71 0.23
72 0.23
73 0.26
74 0.29
75 0.35
76 0.36
77 0.39
78 0.36
79 0.35