Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1ZXI9

Protein Details
Accession A0A1Y1ZXI9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
3-23VTARRPCDECRRQKKGCSKDDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13mito_nucl 13, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MFVTARRPCDECRRQKKGCSKDDGGCVACKVKGMASSFHSSPKRRTETHILERVQTVCIYTFLFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.83
4 0.82
5 0.79
6 0.77
7 0.71
8 0.67
9 0.67
10 0.62
11 0.53
12 0.43
13 0.36
14 0.28
15 0.23
16 0.18
17 0.13
18 0.1
19 0.12
20 0.12
21 0.14
22 0.16
23 0.2
24 0.2
25 0.27
26 0.32
27 0.31
28 0.35
29 0.42
30 0.45
31 0.43
32 0.49
33 0.52
34 0.56
35 0.63
36 0.66
37 0.58
38 0.54
39 0.55
40 0.5
41 0.41
42 0.31
43 0.23
44 0.16
45 0.16