Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CEZ3

Protein Details
Accession A0A1Y2CEZ3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-70APKAEKKKPVSQKARNKEGINHydrophilic
NLS Segment(s)
PositionSequence
48-64EAAPKAEKKKPVSQKAR
Subcellular Location(s) nucl 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MNGKKKDVFGVAADLSDIQGALEQSMEAPELVDEAADGMDEDGTTRKEAAPKAEKKKPVSQKARNKEGINEMLRMQSIMGHKAFKSNPLATIKTHLKNTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.12
4 0.1
5 0.04
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.06
13 0.06
14 0.05
15 0.05
16 0.04
17 0.05
18 0.04
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.05
30 0.05
31 0.06
32 0.06
33 0.07
34 0.11
35 0.12
36 0.18
37 0.26
38 0.34
39 0.41
40 0.47
41 0.52
42 0.54
43 0.62
44 0.66
45 0.67
46 0.69
47 0.72
48 0.77
49 0.8
50 0.84
51 0.81
52 0.72
53 0.65
54 0.61
55 0.59
56 0.5
57 0.42
58 0.34
59 0.29
60 0.28
61 0.24
62 0.17
63 0.14
64 0.14
65 0.16
66 0.17
67 0.18
68 0.18
69 0.25
70 0.25
71 0.27
72 0.32
73 0.29
74 0.34
75 0.38
76 0.39
77 0.35
78 0.43
79 0.46
80 0.45