Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CEA3

Protein Details
Accession A0A1Y2CEA3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23LGKRKSSKKPQAKIKLKLEKDFTHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSKKPQAKIKL
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences LGKRKSSKKPQAKIKLKLEKDFTCMQCNHEMSVQIRIDKNNQVGHLECKKCGVTFQSKTNYLSEPIDVYSDWVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.84
4 0.8
5 0.77
6 0.68
7 0.62
8 0.6
9 0.52
10 0.48
11 0.43
12 0.39
13 0.38
14 0.37
15 0.33
16 0.27
17 0.27
18 0.21
19 0.28
20 0.25
21 0.21
22 0.22
23 0.22
24 0.23
25 0.24
26 0.26
27 0.21
28 0.21
29 0.2
30 0.2
31 0.26
32 0.31
33 0.29
34 0.26
35 0.27
36 0.27
37 0.25
38 0.26
39 0.26
40 0.27
41 0.3
42 0.38
43 0.42
44 0.44
45 0.46
46 0.47
47 0.43
48 0.36
49 0.33
50 0.27
51 0.21
52 0.19
53 0.19
54 0.16
55 0.16