Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CER5

Protein Details
Accession A0A1Y2CER5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
102-126HLMRHVKKRRAFSGRRSPKRNGSEMBasic
NLS Segment(s)
PositionSequence
105-121RHVKKRRAFSGRRSPKR
Subcellular Location(s) nucl 19, cyto 5, mito 1, plas 1, extr 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MEAVSLLPPHLANATASSLKRNYDSEGIVIPRTQSPTLQTPSASPVLINTSQGITSSSSGISCQNCRTSDTPTWRRGEGHNVFLCNACGLYWKTHGNHRPMHLMRHVKKRRAFSGRRSPKRNGSEMD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.22
5 0.23
6 0.24
7 0.26
8 0.26
9 0.25
10 0.24
11 0.25
12 0.22
13 0.24
14 0.24
15 0.22
16 0.21
17 0.18
18 0.17
19 0.2
20 0.19
21 0.16
22 0.18
23 0.24
24 0.27
25 0.26
26 0.24
27 0.22
28 0.25
29 0.25
30 0.21
31 0.14
32 0.12
33 0.15
34 0.15
35 0.15
36 0.11
37 0.1
38 0.1
39 0.11
40 0.11
41 0.08
42 0.08
43 0.08
44 0.08
45 0.07
46 0.08
47 0.11
48 0.11
49 0.11
50 0.13
51 0.16
52 0.16
53 0.2
54 0.2
55 0.23
56 0.28
57 0.36
58 0.41
59 0.43
60 0.45
61 0.43
62 0.43
63 0.39
64 0.43
65 0.37
66 0.38
67 0.34
68 0.33
69 0.32
70 0.31
71 0.29
72 0.2
73 0.16
74 0.08
75 0.1
76 0.1
77 0.12
78 0.15
79 0.19
80 0.21
81 0.3
82 0.36
83 0.39
84 0.43
85 0.43
86 0.5
87 0.48
88 0.52
89 0.52
90 0.56
91 0.58
92 0.64
93 0.69
94 0.68
95 0.72
96 0.75
97 0.76
98 0.76
99 0.77
100 0.76
101 0.79
102 0.81
103 0.86
104 0.84
105 0.82
106 0.82
107 0.82