Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BCZ3

Protein Details
Accession A0A1Y2BCZ3    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-36ESPKQPAPPTAPKGRRNRAPFRAEEHydrophilic
68-88ASMSSKPRSRQQKPPPQTQKSHydrophilic
144-165NDRRKSRGSRARDSKNKNKRGABasic
NLS Segment(s)
PositionSequence
25-27GRR
146-165RRKSRGSRARDSKNKNKRGA
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR029302  IFT43  
Gene Ontology GO:0030991  C:intraciliary transport particle A  
Pfam View protein in Pfam  
PF15305  IFT43  
Amino Acid Sequences MSDDAPPFMVEESPKQPAPPTAPKGRRNRAPFRAEEARISQPNKSQEDLDDENDAPNDDAANLPPGAASMSSKPRSRQQKPPPQTQKSGWGEESLSNPDLSKKQFGRRSQQARDSRRNVDEDEKDRDDDRDDEDEDDDDEDEENDRRKSRGSRARDSKNKNKRGAAGRDEVIMIIPDLNDVEEDEMITTVAAPPSLKVNKVKTIRELDNELAISTGMLSEPGMEGIDFSLLTAYALCPPEMVYEEDRHWDWDVTFTELTSGDKDPSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.32
5 0.38
6 0.42
7 0.45
8 0.51
9 0.6
10 0.68
11 0.76
12 0.81
13 0.82
14 0.81
15 0.84
16 0.83
17 0.81
18 0.76
19 0.74
20 0.73
21 0.65
22 0.61
23 0.55
24 0.54
25 0.52
26 0.5
27 0.45
28 0.42
29 0.48
30 0.46
31 0.43
32 0.37
33 0.32
34 0.38
35 0.38
36 0.34
37 0.3
38 0.27
39 0.26
40 0.25
41 0.23
42 0.16
43 0.12
44 0.1
45 0.07
46 0.08
47 0.07
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.19
58 0.24
59 0.27
60 0.3
61 0.37
62 0.48
63 0.53
64 0.59
65 0.62
66 0.69
67 0.73
68 0.82
69 0.84
70 0.8
71 0.79
72 0.7
73 0.7
74 0.63
75 0.6
76 0.5
77 0.4
78 0.35
79 0.31
80 0.31
81 0.24
82 0.2
83 0.16
84 0.15
85 0.16
86 0.18
87 0.18
88 0.23
89 0.23
90 0.31
91 0.38
92 0.43
93 0.5
94 0.57
95 0.64
96 0.63
97 0.69
98 0.7
99 0.71
100 0.75
101 0.71
102 0.66
103 0.6
104 0.56
105 0.49
106 0.47
107 0.44
108 0.39
109 0.4
110 0.36
111 0.34
112 0.33
113 0.31
114 0.26
115 0.21
116 0.2
117 0.16
118 0.16
119 0.15
120 0.15
121 0.15
122 0.13
123 0.12
124 0.09
125 0.07
126 0.06
127 0.05
128 0.06
129 0.07
130 0.09
131 0.1
132 0.11
133 0.11
134 0.15
135 0.19
136 0.28
137 0.36
138 0.41
139 0.5
140 0.58
141 0.68
142 0.75
143 0.79
144 0.8
145 0.82
146 0.83
147 0.78
148 0.72
149 0.69
150 0.69
151 0.68
152 0.62
153 0.56
154 0.48
155 0.43
156 0.39
157 0.32
158 0.23
159 0.15
160 0.1
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.05
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.06
181 0.13
182 0.15
183 0.18
184 0.23
185 0.27
186 0.35
187 0.42
188 0.44
189 0.44
190 0.5
191 0.51
192 0.49
193 0.5
194 0.42
195 0.4
196 0.37
197 0.3
198 0.22
199 0.18
200 0.14
201 0.09
202 0.08
203 0.04
204 0.04
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.1
222 0.11
223 0.11
224 0.11
225 0.12
226 0.14
227 0.16
228 0.18
229 0.17
230 0.2
231 0.22
232 0.26
233 0.26
234 0.27
235 0.27
236 0.25
237 0.22
238 0.25
239 0.25
240 0.26
241 0.25
242 0.22
243 0.21
244 0.2
245 0.21
246 0.18
247 0.18