Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D004

Protein Details
Accession A0A1Y2D004   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPKATKTKVAKSPKTKAKKDPNAPKKALSHydrophilic
NLS Segment(s)
PositionSequence
6-26KTKVAKSPKTKAKKDPNAPKK
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKATKTKVAKSPKTKAKKDPNAPKKALSAYLLFANDNRARVKEENPDATFGTMGKILGAEWKEASEAVKQKYVALQEKDKERYAKAMANYEAPGDDAEEAEEEAGDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.85
4 0.86
5 0.86
6 0.88
7 0.89
8 0.89
9 0.88
10 0.83
11 0.76
12 0.69
13 0.61
14 0.52
15 0.43
16 0.34
17 0.26
18 0.26
19 0.24
20 0.19
21 0.17
22 0.2
23 0.19
24 0.2
25 0.2
26 0.18
27 0.21
28 0.23
29 0.26
30 0.28
31 0.31
32 0.35
33 0.35
34 0.35
35 0.31
36 0.3
37 0.26
38 0.18
39 0.14
40 0.08
41 0.07
42 0.05
43 0.05
44 0.04
45 0.07
46 0.08
47 0.07
48 0.07
49 0.08
50 0.08
51 0.08
52 0.09
53 0.11
54 0.15
55 0.17
56 0.2
57 0.2
58 0.2
59 0.23
60 0.27
61 0.3
62 0.29
63 0.33
64 0.35
65 0.42
66 0.45
67 0.47
68 0.44
69 0.38
70 0.39
71 0.37
72 0.37
73 0.33
74 0.36
75 0.33
76 0.33
77 0.33
78 0.28
79 0.25
80 0.2
81 0.17
82 0.12
83 0.11
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.07
90 0.06