Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ANK4

Protein Details
Accession A0A1Y2ANK4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-128VTFHTARRTPPCRKRIRRISSAQLSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 4, cysk 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF00646  F-box  
PROSITE View protein in PROSITE  
PS50181  FBOX  
Amino Acid Sequences MDSLPVELATRILCHIDLPEVFKLRRLSKSFNNLLVTEYFITQWFSFSIKEQHPGPVPPINLLLWRTRALQAHSRRIVKVVDSPGLRKAADSHRRSCDPRIAVTFHTARRTPPCRKRIRRISSAQLSSGIPQNPVARFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.13
4 0.14
5 0.17
6 0.21
7 0.24
8 0.24
9 0.29
10 0.34
11 0.35
12 0.43
13 0.44
14 0.46
15 0.49
16 0.59
17 0.58
18 0.58
19 0.56
20 0.48
21 0.45
22 0.39
23 0.33
24 0.24
25 0.19
26 0.14
27 0.11
28 0.14
29 0.12
30 0.12
31 0.1
32 0.11
33 0.11
34 0.12
35 0.18
36 0.17
37 0.2
38 0.2
39 0.23
40 0.24
41 0.25
42 0.26
43 0.24
44 0.23
45 0.2
46 0.2
47 0.17
48 0.16
49 0.17
50 0.15
51 0.13
52 0.14
53 0.15
54 0.16
55 0.18
56 0.19
57 0.26
58 0.3
59 0.36
60 0.4
61 0.41
62 0.38
63 0.38
64 0.36
65 0.29
66 0.29
67 0.23
68 0.23
69 0.22
70 0.23
71 0.24
72 0.25
73 0.24
74 0.18
75 0.2
76 0.26
77 0.35
78 0.38
79 0.41
80 0.45
81 0.5
82 0.53
83 0.53
84 0.51
85 0.44
86 0.44
87 0.42
88 0.39
89 0.35
90 0.38
91 0.38
92 0.34
93 0.37
94 0.33
95 0.33
96 0.4
97 0.46
98 0.51
99 0.57
100 0.64
101 0.69
102 0.79
103 0.86
104 0.87
105 0.89
106 0.87
107 0.86
108 0.86
109 0.85
110 0.78
111 0.68
112 0.6
113 0.51
114 0.44
115 0.42
116 0.33
117 0.24
118 0.25
119 0.28