Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P2E8

Protein Details
Accession G9P2E8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-37RKTPWSRTGCSTCKRRRKKCDGQKPKCQTCLRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPRRVRKTPWSRTGCSTCKRRRKKCDGQKPKCQTCLRLGLECVQFDIFCPINVVTPTRDSRPTRAVTDGEDQEESSPSSSGSADDADVSSNAAESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.72
4 0.72
5 0.75
6 0.82
7 0.85
8 0.87
9 0.89
10 0.92
11 0.92
12 0.94
13 0.94
14 0.93
15 0.93
16 0.92
17 0.88
18 0.86
19 0.78
20 0.7
21 0.64
22 0.64
23 0.56
24 0.48
25 0.42
26 0.38
27 0.37
28 0.33
29 0.28
30 0.19
31 0.15
32 0.13
33 0.16
34 0.1
35 0.08
36 0.1
37 0.09
38 0.1
39 0.11
40 0.12
41 0.09
42 0.13
43 0.15
44 0.17
45 0.24
46 0.25
47 0.29
48 0.34
49 0.36
50 0.35
51 0.36
52 0.34
53 0.31
54 0.35
55 0.32
56 0.28
57 0.25
58 0.23
59 0.2
60 0.2
61 0.17
62 0.12
63 0.11
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.09
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.08