Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C4P0

Protein Details
Accession A0A1Y2C4P0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MQKPRRTRPQLKNVGKQANAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013252  Ndc80_Spc24  
IPR038066  Spc24_Fungi_globular_sf  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF08286  Spc24  
Amino Acid Sequences MQKPRRTRPQLKNVGKQANAAKVAVLEDQQYIIGKKIHEHEKSVTSLEATKRHLLIDLEQLKAKEAAEAALPPDESLLKLNIYKSLGIDLVYNENQEVIRCLVRSVEKNGITPVEMEGAKFSDFFYSNVLWEMMSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.77
3 0.72
4 0.66
5 0.62
6 0.54
7 0.44
8 0.34
9 0.26
10 0.27
11 0.22
12 0.17
13 0.11
14 0.1
15 0.1
16 0.1
17 0.11
18 0.1
19 0.11
20 0.13
21 0.12
22 0.15
23 0.21
24 0.29
25 0.3
26 0.33
27 0.34
28 0.35
29 0.37
30 0.35
31 0.28
32 0.21
33 0.23
34 0.23
35 0.24
36 0.23
37 0.24
38 0.23
39 0.23
40 0.23
41 0.2
42 0.18
43 0.23
44 0.23
45 0.22
46 0.23
47 0.22
48 0.21
49 0.21
50 0.19
51 0.1
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.09
68 0.11
69 0.12
70 0.12
71 0.11
72 0.11
73 0.11
74 0.1
75 0.1
76 0.09
77 0.12
78 0.12
79 0.12
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.09
86 0.11
87 0.11
88 0.11
89 0.14
90 0.18
91 0.21
92 0.25
93 0.31
94 0.31
95 0.32
96 0.33
97 0.31
98 0.27
99 0.24
100 0.2
101 0.16
102 0.14
103 0.13
104 0.13
105 0.14
106 0.14
107 0.13
108 0.12
109 0.13
110 0.14
111 0.15
112 0.17
113 0.17
114 0.17
115 0.19
116 0.19