Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BT87

Protein Details
Accession A0A1Y2BT87    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPKKGKKEKKEKAPKGAPPGDLBasic
NLS Segment(s)
PositionSequence
3-18PKKGKKEKKEKAPKGA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR033585  CCDC153  
Amino Acid Sequences MPPKKGKKEKKEKAPKGAPPGDLDSQEKLNKTSLEIDTLLKELEHETLLNDRLKSASQIQRSRIENLTVELENKQVDRLEITSDMSRQYKSMQSEMTAKINSLEAQVADLKAKLAQSQASSQESTKEYLRIIAIKDEVIEEQNVKMSYMSAEFESMLNETLQKMSRKLDIVSNRWKEQDNMQLSDGNTRKLADFQLNRIIQRQEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.88
4 0.84
5 0.75
6 0.68
7 0.64
8 0.56
9 0.49
10 0.44
11 0.36
12 0.35
13 0.36
14 0.32
15 0.28
16 0.28
17 0.26
18 0.25
19 0.29
20 0.25
21 0.25
22 0.25
23 0.25
24 0.22
25 0.22
26 0.2
27 0.14
28 0.13
29 0.1
30 0.1
31 0.1
32 0.08
33 0.09
34 0.12
35 0.16
36 0.18
37 0.17
38 0.16
39 0.17
40 0.17
41 0.19
42 0.23
43 0.27
44 0.33
45 0.38
46 0.42
47 0.48
48 0.5
49 0.51
50 0.45
51 0.4
52 0.32
53 0.29
54 0.28
55 0.21
56 0.2
57 0.16
58 0.15
59 0.14
60 0.13
61 0.12
62 0.09
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.12
69 0.12
70 0.12
71 0.14
72 0.14
73 0.14
74 0.12
75 0.14
76 0.16
77 0.18
78 0.19
79 0.17
80 0.18
81 0.22
82 0.23
83 0.24
84 0.2
85 0.17
86 0.16
87 0.16
88 0.14
89 0.1
90 0.09
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.1
104 0.12
105 0.15
106 0.16
107 0.17
108 0.17
109 0.19
110 0.19
111 0.2
112 0.18
113 0.16
114 0.14
115 0.15
116 0.16
117 0.14
118 0.14
119 0.14
120 0.14
121 0.12
122 0.13
123 0.12
124 0.11
125 0.1
126 0.1
127 0.09
128 0.08
129 0.11
130 0.11
131 0.11
132 0.1
133 0.1
134 0.1
135 0.1
136 0.11
137 0.08
138 0.09
139 0.09
140 0.09
141 0.1
142 0.09
143 0.09
144 0.08
145 0.08
146 0.08
147 0.1
148 0.14
149 0.16
150 0.17
151 0.19
152 0.23
153 0.25
154 0.26
155 0.31
156 0.35
157 0.4
158 0.49
159 0.53
160 0.52
161 0.52
162 0.53
163 0.47
164 0.45
165 0.48
166 0.43
167 0.4
168 0.38
169 0.4
170 0.38
171 0.45
172 0.41
173 0.33
174 0.29
175 0.26
176 0.26
177 0.25
178 0.28
179 0.29
180 0.31
181 0.33
182 0.42
183 0.44
184 0.44
185 0.47