Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CJ49

Protein Details
Accession A0A1Y2CJ49    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AEEVPNKKPRHRRVVFRADAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038792  CFAP97D1/2  
IPR029488  Hmw/CFAP97  
Pfam View protein in Pfam  
PF13879  Hmw_CFAP97  
Amino Acid Sequences MAEEVPNKKPRHRRVVFRADAVGLEAYEHRHYLPLHPTCNKLLEKRWEDYVRNLHHSRLKQAKPTIDDSKPRVYRHLDMRLKKQQMEEERVHEIEKNNNILFRRIMNQKISHTEISDISKIKEYKENRNHIAASHEHFRKRGMEKILKENLTILQRIEEKAPNYNRLEWYSERCRNLGRKVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.87
3 0.83
4 0.77
5 0.69
6 0.58
7 0.5
8 0.41
9 0.31
10 0.2
11 0.15
12 0.12
13 0.12
14 0.13
15 0.13
16 0.12
17 0.15
18 0.16
19 0.2
20 0.28
21 0.31
22 0.37
23 0.39
24 0.42
25 0.41
26 0.47
27 0.45
28 0.4
29 0.42
30 0.46
31 0.48
32 0.47
33 0.53
34 0.52
35 0.5
36 0.53
37 0.54
38 0.48
39 0.51
40 0.5
41 0.46
42 0.47
43 0.47
44 0.48
45 0.49
46 0.48
47 0.48
48 0.52
49 0.52
50 0.5
51 0.54
52 0.52
53 0.47
54 0.5
55 0.47
56 0.51
57 0.51
58 0.48
59 0.46
60 0.43
61 0.43
62 0.45
63 0.52
64 0.49
65 0.49
66 0.57
67 0.61
68 0.59
69 0.56
70 0.51
71 0.46
72 0.44
73 0.47
74 0.4
75 0.35
76 0.34
77 0.33
78 0.31
79 0.27
80 0.22
81 0.21
82 0.21
83 0.21
84 0.19
85 0.21
86 0.21
87 0.21
88 0.2
89 0.17
90 0.2
91 0.21
92 0.24
93 0.26
94 0.28
95 0.29
96 0.33
97 0.35
98 0.31
99 0.27
100 0.25
101 0.23
102 0.23
103 0.24
104 0.2
105 0.17
106 0.22
107 0.22
108 0.22
109 0.28
110 0.29
111 0.37
112 0.46
113 0.53
114 0.5
115 0.54
116 0.52
117 0.45
118 0.46
119 0.38
120 0.33
121 0.34
122 0.35
123 0.33
124 0.33
125 0.35
126 0.38
127 0.38
128 0.41
129 0.42
130 0.45
131 0.48
132 0.57
133 0.63
134 0.57
135 0.53
136 0.48
137 0.43
138 0.38
139 0.34
140 0.25
141 0.22
142 0.23
143 0.24
144 0.27
145 0.27
146 0.25
147 0.33
148 0.38
149 0.41
150 0.42
151 0.46
152 0.46
153 0.44
154 0.48
155 0.43
156 0.47
157 0.5
158 0.54
159 0.52
160 0.5
161 0.55
162 0.57
163 0.63