Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BVH5

Protein Details
Accession A0A1Y2BVH5   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
101-128TKENTDRKLKKCSRCKAAKYCSVKCQKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 11.5, nucl 6.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MHQVGRHSDFANPSRWIMNPGIVYGPTTPLESVLVDGVIYHHNLARGTCFCQDSNFGRPYSTPSPRFPGKPAEIMCYMGAKGGRPYRPPYACWACRKFVDTKENTDRKLKKCSRCKAAKYCSVKCQKDHWSTHKLSCIEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.31
4 0.26
5 0.28
6 0.22
7 0.21
8 0.21
9 0.19
10 0.2
11 0.16
12 0.18
13 0.13
14 0.14
15 0.12
16 0.11
17 0.12
18 0.11
19 0.11
20 0.08
21 0.07
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.1
31 0.1
32 0.12
33 0.13
34 0.15
35 0.18
36 0.19
37 0.17
38 0.18
39 0.23
40 0.23
41 0.27
42 0.27
43 0.24
44 0.22
45 0.22
46 0.28
47 0.3
48 0.34
49 0.32
50 0.32
51 0.37
52 0.39
53 0.41
54 0.36
55 0.36
56 0.31
57 0.33
58 0.32
59 0.3
60 0.28
61 0.27
62 0.25
63 0.19
64 0.17
65 0.12
66 0.12
67 0.09
68 0.12
69 0.16
70 0.19
71 0.21
72 0.26
73 0.33
74 0.35
75 0.36
76 0.4
77 0.44
78 0.48
79 0.53
80 0.53
81 0.48
82 0.48
83 0.5
84 0.46
85 0.44
86 0.48
87 0.42
88 0.47
89 0.54
90 0.58
91 0.57
92 0.62
93 0.62
94 0.57
95 0.65
96 0.65
97 0.65
98 0.7
99 0.77
100 0.78
101 0.81
102 0.86
103 0.85
104 0.86
105 0.85
106 0.84
107 0.81
108 0.8
109 0.81
110 0.76
111 0.69
112 0.69
113 0.69
114 0.7
115 0.72
116 0.7
117 0.69
118 0.69
119 0.72
120 0.71