Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BEP0

Protein Details
Accession A0A1Y2BEP0    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVTPLNKTKIVKKHPKRFNRHQSDRYVKIDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-21VKKHPKRFNRH
31-48ASWRKPKGIDNRVRRRFK
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVTPLNKTKIVKKHPKRFNRHQSDRYVKIDASWRKPKGIDNRVRRRFKGQIAMPKIGYGSNQITKHLLPSGFRKFLVANVADLDLLLMHNRSYAAEIAHNVSAKNRIAILARAVQLDVKVTNAGARVRAAESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.89
3 0.9
4 0.91
5 0.92
6 0.92
7 0.91
8 0.88
9 0.88
10 0.87
11 0.83
12 0.76
13 0.68
14 0.57
15 0.49
16 0.51
17 0.48
18 0.48
19 0.51
20 0.48
21 0.48
22 0.5
23 0.54
24 0.56
25 0.58
26 0.59
27 0.61
28 0.7
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.58
40 0.5
41 0.44
42 0.38
43 0.29
44 0.24
45 0.17
46 0.14
47 0.18
48 0.18
49 0.18
50 0.19
51 0.19
52 0.2
53 0.19
54 0.16
55 0.12
56 0.18
57 0.23
58 0.23
59 0.23
60 0.23
61 0.21
62 0.22
63 0.24
64 0.19
65 0.13
66 0.12
67 0.13
68 0.11
69 0.11
70 0.09
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.07
80 0.07
81 0.08
82 0.09
83 0.1
84 0.13
85 0.14
86 0.15
87 0.13
88 0.14
89 0.18
90 0.17
91 0.17
92 0.15
93 0.14
94 0.16
95 0.17
96 0.2
97 0.2
98 0.2
99 0.2
100 0.2
101 0.19
102 0.18
103 0.18
104 0.15
105 0.11
106 0.11
107 0.1
108 0.12
109 0.14
110 0.15
111 0.15
112 0.16
113 0.17