Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BMK7

Protein Details
Accession A0A1Y2BMK7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-102PTMQHPRLHKRSHKKLTRRFNIQMHydrophilic
NLS Segment(s)
PositionSequence
83-94HPRLHKRSHKKL
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MNPVNPALHRNLSNHSPFLEPKSSTRPLQRVPNKYNIYIPLPNNPTCLVSPSQLPNPTSYPPIQPIIHSLRIHIRRRNPTMQHPRLHKRSHKKLTRRFNIQMQPLLSAPFPEVEHVQDYCGGRWVCEWRDVEVLWEVWWRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.34
4 0.33
5 0.36
6 0.36
7 0.31
8 0.32
9 0.38
10 0.41
11 0.42
12 0.48
13 0.49
14 0.49
15 0.58
16 0.63
17 0.65
18 0.65
19 0.71
20 0.66
21 0.61
22 0.59
23 0.52
24 0.48
25 0.44
26 0.41
27 0.39
28 0.4
29 0.38
30 0.36
31 0.33
32 0.3
33 0.24
34 0.26
35 0.19
36 0.15
37 0.18
38 0.19
39 0.23
40 0.25
41 0.25
42 0.24
43 0.25
44 0.25
45 0.25
46 0.24
47 0.21
48 0.2
49 0.23
50 0.21
51 0.18
52 0.22
53 0.24
54 0.28
55 0.26
56 0.25
57 0.29
58 0.37
59 0.42
60 0.42
61 0.45
62 0.47
63 0.54
64 0.6
65 0.57
66 0.6
67 0.66
68 0.68
69 0.66
70 0.66
71 0.69
72 0.69
73 0.72
74 0.71
75 0.7
76 0.74
77 0.79
78 0.8
79 0.81
80 0.84
81 0.87
82 0.87
83 0.85
84 0.79
85 0.78
86 0.76
87 0.7
88 0.65
89 0.55
90 0.48
91 0.39
92 0.35
93 0.26
94 0.19
95 0.15
96 0.12
97 0.11
98 0.11
99 0.12
100 0.13
101 0.15
102 0.15
103 0.15
104 0.18
105 0.19
106 0.18
107 0.24
108 0.22
109 0.19
110 0.23
111 0.28
112 0.26
113 0.31
114 0.32
115 0.28
116 0.32
117 0.31
118 0.31
119 0.27
120 0.26
121 0.2