Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CFF9

Protein Details
Accession A0A1Y2CFF9    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-97ASTTIKKRVRVKRTSPLRMYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 10.166, cyto_nucl 9.833, mito 9.5, cyto 9.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MSFTIPSSSSTHPMPPLSSILFSSNQSTSSSFSYITCHNCATTETPMWRRDLQGRSVCNACGVYFRVNGVNRIVKSGASTTIKKRVRVKRTSPLRMYPSNTHMTDMDLFMSENVMKYVPIEPSSARDSITIPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.26
4 0.24
5 0.23
6 0.21
7 0.2
8 0.21
9 0.2
10 0.21
11 0.19
12 0.18
13 0.19
14 0.18
15 0.18
16 0.18
17 0.18
18 0.15
19 0.15
20 0.17
21 0.19
22 0.22
23 0.21
24 0.2
25 0.19
26 0.19
27 0.2
28 0.21
29 0.2
30 0.2
31 0.23
32 0.27
33 0.28
34 0.31
35 0.31
36 0.3
37 0.34
38 0.34
39 0.36
40 0.37
41 0.37
42 0.36
43 0.36
44 0.34
45 0.27
46 0.24
47 0.17
48 0.12
49 0.13
50 0.12
51 0.11
52 0.12
53 0.15
54 0.15
55 0.16
56 0.17
57 0.19
58 0.18
59 0.19
60 0.19
61 0.15
62 0.15
63 0.15
64 0.17
65 0.16
66 0.19
67 0.2
68 0.3
69 0.34
70 0.38
71 0.47
72 0.52
73 0.58
74 0.65
75 0.69
76 0.7
77 0.77
78 0.81
79 0.76
80 0.74
81 0.71
82 0.67
83 0.65
84 0.6
85 0.54
86 0.52
87 0.47
88 0.41
89 0.35
90 0.32
91 0.28
92 0.23
93 0.19
94 0.13
95 0.12
96 0.1
97 0.12
98 0.09
99 0.08
100 0.09
101 0.08
102 0.08
103 0.09
104 0.12
105 0.13
106 0.14
107 0.16
108 0.16
109 0.21
110 0.25
111 0.24
112 0.22
113 0.2