Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C494

Protein Details
Accession A0A1Y2C494    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34AFVGHPRPPRKQNLNRRWIAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 6, E.R. 5, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023352  MAPEG-like_dom_sf  
IPR001129  Membr-assoc_MAPEG  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01124  MAPEG  
Amino Acid Sequences MSSPLLPATGVWTVAFVGHPRPPRKQNLNRRWIAQLEAMIAADKPAAEIAKFKAVVRQLQFDIRCHANFTENVPFSVLVIGAAELNGVDVKVVHAFLAVLFVARVSVGVTLTGFVTLAAAIASAVKVFGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.09
4 0.12
5 0.17
6 0.25
7 0.3
8 0.38
9 0.44
10 0.53
11 0.63
12 0.7
13 0.76
14 0.79
15 0.84
16 0.8
17 0.76
18 0.7
19 0.61
20 0.53
21 0.43
22 0.33
23 0.24
24 0.21
25 0.18
26 0.13
27 0.12
28 0.09
29 0.07
30 0.05
31 0.04
32 0.05
33 0.05
34 0.05
35 0.07
36 0.08
37 0.13
38 0.14
39 0.14
40 0.17
41 0.19
42 0.24
43 0.24
44 0.25
45 0.22
46 0.26
47 0.28
48 0.25
49 0.26
50 0.23
51 0.22
52 0.2
53 0.19
54 0.16
55 0.16
56 0.18
57 0.21
58 0.2
59 0.2
60 0.19
61 0.18
62 0.16
63 0.16
64 0.12
65 0.05
66 0.05
67 0.05
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.05
80 0.04
81 0.05
82 0.05
83 0.05
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.04
91 0.05
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04