Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2B304

Protein Details
Accession A0A1Y2B304    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-90KKPPKWAKSCEPCRNHKRKCDLEKPSCSGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDKPHHSYHNIQRMPKARWGRPLPCISCRAINRKCSLEEPSCQRCRERGEHCVYDEEAELPKKPPKWAKSCEPCRNHKRKCDLEKPSCSGCVGRGIECVYAGPQITNDPFLRRLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.64
3 0.63
4 0.57
5 0.61
6 0.67
7 0.64
8 0.65
9 0.69
10 0.65
11 0.61
12 0.59
13 0.51
14 0.51
15 0.51
16 0.52
17 0.49
18 0.51
19 0.5
20 0.5
21 0.5
22 0.45
23 0.46
24 0.4
25 0.4
26 0.41
27 0.46
28 0.48
29 0.47
30 0.45
31 0.43
32 0.45
33 0.47
34 0.44
35 0.44
36 0.46
37 0.47
38 0.46
39 0.45
40 0.39
41 0.32
42 0.27
43 0.19
44 0.14
45 0.12
46 0.12
47 0.12
48 0.15
49 0.16
50 0.21
51 0.27
52 0.33
53 0.4
54 0.45
55 0.53
56 0.61
57 0.7
58 0.74
59 0.74
60 0.76
61 0.79
62 0.84
63 0.81
64 0.8
65 0.79
66 0.79
67 0.82
68 0.83
69 0.82
70 0.81
71 0.81
72 0.77
73 0.7
74 0.61
75 0.53
76 0.43
77 0.34
78 0.33
79 0.27
80 0.22
81 0.22
82 0.22
83 0.22
84 0.21
85 0.2
86 0.13
87 0.13
88 0.12
89 0.1
90 0.09
91 0.13
92 0.15
93 0.19
94 0.2
95 0.22
96 0.23