Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BVU4

Protein Details
Accession A0A1Y2BVU4   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
4-36ATRKPGKTGKSVTPKKRPGKKRYYYKSEPQICSHydrophilic
NLS Segment(s)
PositionSequence
5-25TRKPGKTGKSVTPKKRPGKKR
Subcellular Location(s) nucl 14.5, mito_nucl 11.833, cyto_nucl 10.166, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLKATRKPGKTGKSVTPKKRPGKKRYYYKSEPQICSCGWSTEHVRLLHIAEHVIKNPDCQVPCPIQGCNFLIDYSNMANHLVQAHFEVAIKNNKVFVVLFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.8
4 0.82
5 0.84
6 0.88
7 0.88
8 0.88
9 0.89
10 0.89
11 0.89
12 0.9
13 0.89
14 0.86
15 0.85
16 0.85
17 0.83
18 0.77
19 0.69
20 0.62
21 0.52
22 0.48
23 0.39
24 0.3
25 0.22
26 0.21
27 0.21
28 0.22
29 0.27
30 0.24
31 0.23
32 0.22
33 0.22
34 0.2
35 0.17
36 0.13
37 0.1
38 0.1
39 0.11
40 0.13
41 0.13
42 0.12
43 0.14
44 0.17
45 0.16
46 0.17
47 0.19
48 0.19
49 0.22
50 0.23
51 0.22
52 0.2
53 0.23
54 0.23
55 0.21
56 0.19
57 0.15
58 0.15
59 0.14
60 0.14
61 0.11
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.12
68 0.1
69 0.1
70 0.11
71 0.11
72 0.11
73 0.12
74 0.12
75 0.15
76 0.23
77 0.25
78 0.24
79 0.25
80 0.25
81 0.26