Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NKU0

Protein Details
Accession G9NKU0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
25-49LIDTTAKKPRKRPKEKTYNSRCSPMHydrophilic
NLS Segment(s)
PositionSequence
31-39KKPRKRPKE
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGEQTGPRIFHYLWSYVLVSVLSLLIDTTAKKPRKRPKEKTYNSRCSPMVTHLTTNLPVSGLSMGEQTGPRILHYLWSYVLEYTTKINYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.2
4 0.21
5 0.15
6 0.11
7 0.09
8 0.08
9 0.05
10 0.04
11 0.04
12 0.04
13 0.05
14 0.06
15 0.09
16 0.18
17 0.24
18 0.29
19 0.38
20 0.48
21 0.59
22 0.69
23 0.76
24 0.78
25 0.84
26 0.89
27 0.91
28 0.91
29 0.9
30 0.81
31 0.75
32 0.64
33 0.55
34 0.46
35 0.4
36 0.35
37 0.26
38 0.24
39 0.22
40 0.23
41 0.22
42 0.21
43 0.17
44 0.11
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.08
54 0.08
55 0.11
56 0.11
57 0.11
58 0.13
59 0.13
60 0.17
61 0.18
62 0.19
63 0.17
64 0.19
65 0.2
66 0.18
67 0.19
68 0.14
69 0.14
70 0.15