Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BVS7

Protein Details
Accession A0A1Y2BVS7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-123TKPVKQKLSQRKSLSRNQQRLQRQPHRNSPSQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016177  DNA-bd_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MTSKQRATGHLDCTWVAPNGLKFRSYKSVQDYCDKNGIQLSSSNIINNHEVHHDPEIQAVLEESIASSHAVTVSAASNHEDDEEDEEVPLTKPVKQKLSQRKSLSRNQQRLQRQPHRNSPSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.26
3 0.21
4 0.18
5 0.21
6 0.25
7 0.26
8 0.27
9 0.25
10 0.29
11 0.36
12 0.37
13 0.38
14 0.39
15 0.44
16 0.45
17 0.52
18 0.5
19 0.46
20 0.5
21 0.44
22 0.36
23 0.33
24 0.3
25 0.23
26 0.22
27 0.21
28 0.17
29 0.17
30 0.17
31 0.15
32 0.17
33 0.17
34 0.16
35 0.14
36 0.13
37 0.14
38 0.15
39 0.16
40 0.15
41 0.13
42 0.14
43 0.13
44 0.1
45 0.09
46 0.08
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.06
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.11
70 0.12
71 0.1
72 0.1
73 0.1
74 0.11
75 0.11
76 0.12
77 0.1
78 0.13
79 0.17
80 0.23
81 0.3
82 0.35
83 0.45
84 0.54
85 0.63
86 0.68
87 0.72
88 0.76
89 0.76
90 0.8
91 0.81
92 0.81
93 0.82
94 0.79
95 0.8
96 0.8
97 0.83
98 0.84
99 0.84
100 0.83
101 0.82
102 0.87
103 0.86