Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AV20

Protein Details
Accession A0A1Y2AV20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26SRSRPFPCPTCPKRFLRKQDLARHEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto_nucl 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF13894  zf-C2H2_4  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SRSRPFPCPTCPKRFLRKQDLARHEATHTRDKKFVCSGCGTGFARQDALGRHTKSCMFNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.8
4 0.82
5 0.81
6 0.84
7 0.83
8 0.77
9 0.69
10 0.61
11 0.52
12 0.48
13 0.42
14 0.41
15 0.38
16 0.36
17 0.38
18 0.36
19 0.38
20 0.39
21 0.37
22 0.31
23 0.3
24 0.29
25 0.26
26 0.32
27 0.29
28 0.26
29 0.26
30 0.23
31 0.21
32 0.19
33 0.2
34 0.17
35 0.21
36 0.26
37 0.26
38 0.27
39 0.3
40 0.35