Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P4S8

Protein Details
Accession G9P4S8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-68RQKSLMASDPRRKKRGRRGDSBasic
NLS Segment(s)
PositionSequence
57-66PRRKKRGRRG
Subcellular Location(s) mito 13.5, mito_nucl 12.333, nucl 10, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MTGSRGKMAGAPVLGTKTPPRMQMPYFGCSLFIYDSSWLPFEKGSSLRQKSLMASDPRRKKRGRRGDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.2
5 0.22
6 0.26
7 0.28
8 0.31
9 0.31
10 0.39
11 0.4
12 0.35
13 0.34
14 0.29
15 0.26
16 0.21
17 0.22
18 0.13
19 0.1
20 0.08
21 0.08
22 0.09
23 0.08
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.1
30 0.12
31 0.17
32 0.26
33 0.29
34 0.31
35 0.33
36 0.34
37 0.32
38 0.35
39 0.37
40 0.36
41 0.42
42 0.5
43 0.59
44 0.66
45 0.73
46 0.76
47 0.79
48 0.81