Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BG91

Protein Details
Accession A0A1Y2BG91    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
36-57AAGGRTTKNKKKREEKKVAVAGHydrophilic
NLS Segment(s)
PositionSequence
43-52KNKKKREEKK
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MKVLRRWLKVTGRREVVMTDHGMEVDDVGSVDVGLAAGGRTTKNKKKREEKKVAVAGVEEANVDVVPEKVDMVAELESSSETQAVDIPNMDVALTEVQYLFSRSESRAESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.49
3 0.41
4 0.36
5 0.31
6 0.23
7 0.18
8 0.17
9 0.16
10 0.15
11 0.12
12 0.08
13 0.06
14 0.05
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.02
23 0.02
24 0.03
25 0.04
26 0.04
27 0.09
28 0.17
29 0.25
30 0.35
31 0.43
32 0.52
33 0.63
34 0.73
35 0.79
36 0.83
37 0.81
38 0.81
39 0.79
40 0.7
41 0.59
42 0.49
43 0.38
44 0.28
45 0.22
46 0.12
47 0.06
48 0.05
49 0.05
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.07
71 0.08
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.08
78 0.06
79 0.07
80 0.08
81 0.07
82 0.07
83 0.07
84 0.09
85 0.09
86 0.11
87 0.11
88 0.11
89 0.14
90 0.15
91 0.2