Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C1C1

Protein Details
Accession A0A1Y2C1C1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
169-193VNAPRRDGRQHMKHKKEFKTRRGSTBasic
NLS Segment(s)
PositionSequence
145-154PKARRVRVRI
167-190KTVNAPRRDGRQHMKHKKEFKTRR
252-265KKSEKKAPLRRSAR
Subcellular Location(s) mito 13, cyto_nucl 4.5, cyto 4, nucl 3, extr 3, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MNPDYVARFRNFVPLPPVIPRFGVPGESAFGLAEFPRSLIPVPVIVPVIPPVASPKVLVGRPATPRFGLSGTAAGRVLQIPPVKKARISVAREKLSPSNYLIYARRRQLGTISLQLPPNASQKVEPLPPVGLKPVPEVPAEAVRPKARRVRVRIPAPEVQLNKALGKTVNAPRRDGRQHMKHKKEFKTRRGSTLVQVYPKQLVVVAAAVELVEVVPVVESVAVNNELQLVDAVSENESVVNIVKEVLSVAEKKSEKKAPLRRSARIASQTVRRSARLANLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.39
4 0.41
5 0.33
6 0.34
7 0.3
8 0.29
9 0.26
10 0.25
11 0.19
12 0.18
13 0.18
14 0.17
15 0.17
16 0.12
17 0.11
18 0.1
19 0.09
20 0.1
21 0.08
22 0.08
23 0.08
24 0.1
25 0.1
26 0.11
27 0.12
28 0.12
29 0.12
30 0.14
31 0.14
32 0.13
33 0.12
34 0.12
35 0.12
36 0.1
37 0.1
38 0.12
39 0.14
40 0.14
41 0.14
42 0.16
43 0.2
44 0.21
45 0.23
46 0.22
47 0.26
48 0.33
49 0.36
50 0.35
51 0.3
52 0.3
53 0.3
54 0.28
55 0.23
56 0.16
57 0.18
58 0.16
59 0.17
60 0.17
61 0.15
62 0.14
63 0.13
64 0.13
65 0.12
66 0.15
67 0.15
68 0.21
69 0.26
70 0.26
71 0.27
72 0.28
73 0.32
74 0.38
75 0.42
76 0.47
77 0.51
78 0.53
79 0.53
80 0.54
81 0.49
82 0.42
83 0.38
84 0.3
85 0.24
86 0.22
87 0.25
88 0.26
89 0.28
90 0.32
91 0.33
92 0.35
93 0.33
94 0.32
95 0.31
96 0.3
97 0.27
98 0.27
99 0.25
100 0.24
101 0.24
102 0.24
103 0.23
104 0.21
105 0.21
106 0.17
107 0.15
108 0.13
109 0.15
110 0.18
111 0.18
112 0.17
113 0.14
114 0.15
115 0.15
116 0.15
117 0.15
118 0.12
119 0.11
120 0.13
121 0.14
122 0.14
123 0.14
124 0.14
125 0.13
126 0.15
127 0.16
128 0.14
129 0.15
130 0.17
131 0.18
132 0.22
133 0.27
134 0.31
135 0.38
136 0.45
137 0.51
138 0.57
139 0.63
140 0.63
141 0.62
142 0.59
143 0.55
144 0.52
145 0.44
146 0.36
147 0.32
148 0.28
149 0.24
150 0.19
151 0.18
152 0.13
153 0.13
154 0.17
155 0.22
156 0.28
157 0.28
158 0.31
159 0.33
160 0.4
161 0.43
162 0.43
163 0.45
164 0.49
165 0.59
166 0.66
167 0.74
168 0.75
169 0.8
170 0.83
171 0.85
172 0.84
173 0.83
174 0.83
175 0.77
176 0.76
177 0.72
178 0.65
179 0.59
180 0.58
181 0.52
182 0.46
183 0.44
184 0.39
185 0.34
186 0.32
187 0.27
188 0.18
189 0.14
190 0.1
191 0.09
192 0.08
193 0.06
194 0.06
195 0.05
196 0.05
197 0.04
198 0.03
199 0.02
200 0.02
201 0.02
202 0.02
203 0.02
204 0.03
205 0.03
206 0.03
207 0.04
208 0.06
209 0.08
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.08
216 0.06
217 0.06
218 0.06
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.06
229 0.07
230 0.07
231 0.07
232 0.07
233 0.08
234 0.09
235 0.11
236 0.12
237 0.2
238 0.22
239 0.26
240 0.33
241 0.39
242 0.44
243 0.52
244 0.61
245 0.63
246 0.72
247 0.77
248 0.76
249 0.77
250 0.76
251 0.74
252 0.71
253 0.66
254 0.62
255 0.63
256 0.63
257 0.63
258 0.61
259 0.53
260 0.49
261 0.48