Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BYT9

Protein Details
Accession A0A1Y2BYT9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEWRRSQCRKTQRSRMLLHLPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036603  RBP11-like  
IPR009025  RBP11-like_dimer  
Gene Ontology GO:0055029  C:nuclear DNA-directed RNA polymerase complex  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF13656  RNA_pol_L_2  
Amino Acid Sequences MEWRRSQCRKTQRSRMLLHLPSSKKTIPSLTSESTTPQKSKSSLCGYKIPHPLEHTFILKIQTTPDTNPLDVFILESANIIRELGDLNKKFQVSPLSELERAGCSICMIGWSRSQCELQEEMEGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.8
4 0.73
5 0.69
6 0.66
7 0.59
8 0.53
9 0.54
10 0.47
11 0.39
12 0.37
13 0.36
14 0.3
15 0.33
16 0.36
17 0.33
18 0.33
19 0.31
20 0.32
21 0.33
22 0.34
23 0.29
24 0.26
25 0.26
26 0.27
27 0.28
28 0.32
29 0.36
30 0.37
31 0.4
32 0.44
33 0.44
34 0.5
35 0.55
36 0.5
37 0.43
38 0.41
39 0.39
40 0.36
41 0.35
42 0.28
43 0.21
44 0.2
45 0.19
46 0.16
47 0.15
48 0.13
49 0.13
50 0.13
51 0.13
52 0.17
53 0.17
54 0.17
55 0.17
56 0.16
57 0.14
58 0.13
59 0.13
60 0.07
61 0.06
62 0.05
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.04
69 0.04
70 0.06
71 0.09
72 0.16
73 0.17
74 0.19
75 0.23
76 0.23
77 0.23
78 0.25
79 0.28
80 0.24
81 0.28
82 0.31
83 0.32
84 0.33
85 0.33
86 0.31
87 0.26
88 0.23
89 0.19
90 0.14
91 0.09
92 0.09
93 0.09
94 0.1
95 0.12
96 0.13
97 0.18
98 0.21
99 0.23
100 0.26
101 0.28
102 0.26
103 0.28
104 0.29
105 0.25