Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2D2N5

Protein Details
Accession A0A1Y2D2N5    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-71FFKDDTKGKLRRRKMPVRDFVNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13.833, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR029412  CEP19  
Gene Ontology GO:0005814  C:centriole  
GO:0005929  C:cilium  
GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF14933  CEP19  
Amino Acid Sequences MTTRRREYSFEPEDYDGTLDGAKAVSTKLSRYVPQELGAKFSPPTVYLFFKDDTKGKLRRRKMPVRDFVNSSSDILSTDAIAKNLVKRHPVLECVPLHRITTILNKLRVHHNLPEPAPVNISLSSKSNIAALPSLPQKSRTFPNPTTNSFGNGEDQIHLDGNMDLNKLSDNDLSKIKAEMNDDFEKNRVKPGDPNFKYDIQKTFESANEENDWDTSDSKPTTHPKPFGELETMMMKFLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.25
4 0.18
5 0.15
6 0.11
7 0.09
8 0.08
9 0.07
10 0.07
11 0.07
12 0.11
13 0.11
14 0.13
15 0.19
16 0.23
17 0.26
18 0.31
19 0.37
20 0.35
21 0.38
22 0.43
23 0.37
24 0.39
25 0.36
26 0.32
27 0.26
28 0.25
29 0.22
30 0.16
31 0.19
32 0.18
33 0.2
34 0.21
35 0.24
36 0.24
37 0.24
38 0.27
39 0.27
40 0.28
41 0.32
42 0.39
43 0.45
44 0.53
45 0.6
46 0.66
47 0.73
48 0.79
49 0.82
50 0.84
51 0.84
52 0.82
53 0.78
54 0.72
55 0.65
56 0.57
57 0.48
58 0.38
59 0.29
60 0.22
61 0.18
62 0.14
63 0.12
64 0.08
65 0.11
66 0.1
67 0.1
68 0.11
69 0.11
70 0.14
71 0.18
72 0.2
73 0.19
74 0.19
75 0.22
76 0.23
77 0.26
78 0.24
79 0.26
80 0.26
81 0.26
82 0.28
83 0.27
84 0.25
85 0.21
86 0.2
87 0.15
88 0.2
89 0.24
90 0.25
91 0.29
92 0.29
93 0.31
94 0.37
95 0.39
96 0.35
97 0.33
98 0.33
99 0.33
100 0.32
101 0.35
102 0.3
103 0.27
104 0.24
105 0.19
106 0.17
107 0.13
108 0.14
109 0.1
110 0.1
111 0.11
112 0.11
113 0.1
114 0.1
115 0.09
116 0.09
117 0.09
118 0.07
119 0.1
120 0.13
121 0.15
122 0.14
123 0.18
124 0.18
125 0.21
126 0.25
127 0.28
128 0.33
129 0.36
130 0.45
131 0.47
132 0.48
133 0.5
134 0.47
135 0.43
136 0.37
137 0.33
138 0.25
139 0.21
140 0.19
141 0.14
142 0.15
143 0.12
144 0.11
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.09
151 0.08
152 0.08
153 0.08
154 0.08
155 0.1
156 0.11
157 0.12
158 0.14
159 0.16
160 0.17
161 0.18
162 0.18
163 0.18
164 0.19
165 0.2
166 0.2
167 0.25
168 0.28
169 0.29
170 0.29
171 0.3
172 0.32
173 0.3
174 0.33
175 0.29
176 0.27
177 0.33
178 0.42
179 0.5
180 0.47
181 0.53
182 0.51
183 0.55
184 0.57
185 0.53
186 0.49
187 0.43
188 0.42
189 0.38
190 0.36
191 0.33
192 0.36
193 0.32
194 0.31
195 0.28
196 0.28
197 0.27
198 0.24
199 0.24
200 0.18
201 0.19
202 0.15
203 0.19
204 0.19
205 0.19
206 0.26
207 0.3
208 0.38
209 0.45
210 0.5
211 0.47
212 0.54
213 0.56
214 0.53
215 0.51
216 0.42
217 0.37
218 0.37
219 0.34