Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NFK7

Protein Details
Accession G9NFK7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-62HCMYMNTKQQQRRRQKRKKPESVQTKKDPQAHHydrophilic
NLS Segment(s)
PositionSequence
42-52RRRQKRKKPES
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 5
Family & Domain DBs
Amino Acid Sequences MLEANALVRHANMPNRQRGMCLQKVSRGTLHCMYMNTKQQQRRRQKRKKPESVQTKKDPQAHANSPTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.46
4 0.45
5 0.48
6 0.49
7 0.47
8 0.47
9 0.41
10 0.42
11 0.44
12 0.44
13 0.41
14 0.34
15 0.33
16 0.29
17 0.29
18 0.24
19 0.23
20 0.24
21 0.25
22 0.31
23 0.31
24 0.34
25 0.4
26 0.47
27 0.56
28 0.64
29 0.7
30 0.75
31 0.81
32 0.86
33 0.9
34 0.94
35 0.95
36 0.93
37 0.92
38 0.93
39 0.92
40 0.9
41 0.88
42 0.86
43 0.82
44 0.8
45 0.74
46 0.69
47 0.68
48 0.65
49 0.65