Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9PAT7

Protein Details
Accession G9PAT7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
103-127ACSVQWKTSKPKPKQKASGSSRKNGHydrophilic
NLS Segment(s)
PositionSequence
113-118PKPKQK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 10.666, cyto 6
Family & Domain DBs
Amino Acid Sequences MEPISTPAEVTQSHAVPQQSPSLPQSNEPAADLVEQESTDESYIEGRLDIDEKRKRFDETSCSLEEKELSDLFKKGLLDDGSTGPLKGDFTLHDLPQLIGDEACSVQWKTSKPKPKQKASGSSRKNGQETKGLTDDELASVLQACPDLEGFITKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.25
5 0.27
6 0.24
7 0.26
8 0.29
9 0.32
10 0.31
11 0.32
12 0.35
13 0.3
14 0.3
15 0.28
16 0.24
17 0.18
18 0.17
19 0.16
20 0.12
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.07
35 0.08
36 0.1
37 0.18
38 0.24
39 0.25
40 0.29
41 0.3
42 0.33
43 0.33
44 0.36
45 0.34
46 0.32
47 0.36
48 0.34
49 0.34
50 0.31
51 0.29
52 0.25
53 0.19
54 0.16
55 0.12
56 0.11
57 0.11
58 0.12
59 0.12
60 0.13
61 0.12
62 0.1
63 0.12
64 0.12
65 0.11
66 0.12
67 0.12
68 0.12
69 0.12
70 0.12
71 0.08
72 0.08
73 0.08
74 0.07
75 0.07
76 0.05
77 0.11
78 0.14
79 0.14
80 0.14
81 0.15
82 0.14
83 0.15
84 0.15
85 0.1
86 0.07
87 0.07
88 0.07
89 0.06
90 0.07
91 0.08
92 0.07
93 0.08
94 0.12
95 0.15
96 0.22
97 0.31
98 0.41
99 0.49
100 0.6
101 0.69
102 0.76
103 0.82
104 0.83
105 0.86
106 0.84
107 0.85
108 0.8
109 0.78
110 0.75
111 0.71
112 0.68
113 0.6
114 0.55
115 0.52
116 0.49
117 0.48
118 0.44
119 0.38
120 0.33
121 0.31
122 0.29
123 0.21
124 0.19
125 0.12
126 0.09
127 0.1
128 0.09
129 0.08
130 0.08
131 0.07
132 0.07
133 0.08
134 0.08
135 0.08