Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2AHT7

Protein Details
Accession A0A1Y2AHT7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-39LTNTPTKWARPPTKKRPSSAAHydrophilic
NLS Segment(s)
PositionSequence
30-35PTKKRP
Subcellular Location(s) mito 18.5, cyto_mito 12.833, cyto 6, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MAMIKRYSDRRSMLELSALTNTPTKWARPPTKKRPSSAAPSKRSLADPGLAPFALTSSVSGSESGEATFAVTVKALKGATGPCAVAGFSAFDSVDALKTKAAKALNVDAANVRLVFKGKALAGQGKTLQDFGLSQGAVVHVMIVAGTASDEKKDKDPFNEAAASIGRTRSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.33
4 0.31
5 0.27
6 0.22
7 0.2
8 0.19
9 0.2
10 0.21
11 0.21
12 0.26
13 0.36
14 0.45
15 0.54
16 0.65
17 0.71
18 0.8
19 0.83
20 0.8
21 0.78
22 0.75
23 0.74
24 0.75
25 0.74
26 0.68
27 0.66
28 0.64
29 0.58
30 0.53
31 0.45
32 0.36
33 0.29
34 0.24
35 0.22
36 0.21
37 0.19
38 0.17
39 0.13
40 0.11
41 0.1
42 0.08
43 0.07
44 0.05
45 0.07
46 0.07
47 0.08
48 0.08
49 0.07
50 0.08
51 0.07
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.1
68 0.1
69 0.08
70 0.08
71 0.08
72 0.06
73 0.06
74 0.05
75 0.04
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.09
87 0.12
88 0.13
89 0.12
90 0.14
91 0.17
92 0.21
93 0.2
94 0.21
95 0.17
96 0.18
97 0.17
98 0.15
99 0.12
100 0.08
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.12
107 0.14
108 0.19
109 0.18
110 0.21
111 0.23
112 0.22
113 0.22
114 0.21
115 0.18
116 0.13
117 0.12
118 0.12
119 0.13
120 0.11
121 0.1
122 0.1
123 0.11
124 0.1
125 0.1
126 0.08
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.05
135 0.05
136 0.08
137 0.1
138 0.13
139 0.19
140 0.27
141 0.3
142 0.34
143 0.4
144 0.41
145 0.43
146 0.44
147 0.37
148 0.33
149 0.31
150 0.28
151 0.23
152 0.21