Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2C5T9

Protein Details
Accession A0A1Y2C5T9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-65QTSIRRFDKEKRKEQNKVASKLHydrophilic
NLS Segment(s)
PositionSequence
52-67KEKRKEQNKVASKLHR
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14686  bZIP  
Amino Acid Sequences MRSSSNRSHSHSSSLSASSDQSDDDTFTLTTSEHPHLTQHNRNQTSIRRFDKEKRKEQNKVASKLHRQKKTAYKQELEMKLESLLSKEGGNSVENEQLKVRIQQLEAENYNLLQLQKLTVDSTPSMPVIPNTRPQHLVYDNPPPIIVVSPVQEEPKLKHKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.27
4 0.26
5 0.2
6 0.19
7 0.16
8 0.14
9 0.13
10 0.13
11 0.12
12 0.13
13 0.11
14 0.1
15 0.11
16 0.09
17 0.1
18 0.14
19 0.16
20 0.16
21 0.16
22 0.18
23 0.25
24 0.33
25 0.4
26 0.44
27 0.51
28 0.52
29 0.54
30 0.56
31 0.58
32 0.58
33 0.58
34 0.55
35 0.5
36 0.53
37 0.61
38 0.66
39 0.67
40 0.69
41 0.71
42 0.75
43 0.78
44 0.81
45 0.82
46 0.8
47 0.77
48 0.74
49 0.71
50 0.72
51 0.74
52 0.74
53 0.7
54 0.63
55 0.64
56 0.68
57 0.7
58 0.7
59 0.67
60 0.6
61 0.58
62 0.65
63 0.61
64 0.53
65 0.43
66 0.33
67 0.27
68 0.26
69 0.2
70 0.13
71 0.09
72 0.07
73 0.07
74 0.06
75 0.07
76 0.08
77 0.08
78 0.09
79 0.1
80 0.15
81 0.15
82 0.16
83 0.15
84 0.15
85 0.16
86 0.17
87 0.18
88 0.15
89 0.15
90 0.19
91 0.22
92 0.26
93 0.25
94 0.25
95 0.22
96 0.19
97 0.19
98 0.16
99 0.14
100 0.09
101 0.08
102 0.07
103 0.08
104 0.09
105 0.1
106 0.09
107 0.11
108 0.12
109 0.13
110 0.14
111 0.14
112 0.13
113 0.13
114 0.15
115 0.17
116 0.19
117 0.27
118 0.29
119 0.33
120 0.35
121 0.36
122 0.41
123 0.39
124 0.42
125 0.37
126 0.43
127 0.42
128 0.39
129 0.38
130 0.31
131 0.28
132 0.24
133 0.22
134 0.13
135 0.14
136 0.16
137 0.18
138 0.2
139 0.22
140 0.23
141 0.25