Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2C7T1

Protein Details
Accession A0A1Y2C7T1    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
16-35WSQPIGFKYRHPRSHIKYIWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_nucl 10.833, cyto_pero 10.333, nucl 4.5, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001544  Aminotrans_IV  
IPR036038  Aminotransferase-like  
IPR005786  B_amino_transII  
IPR043132  BCAT-like_C  
IPR043131  BCAT-like_N  
IPR033939  BCAT_family  
Gene Ontology GO:0004084  F:branched-chain-amino-acid transaminase activity  
GO:0009081  P:branched-chain amino acid metabolic process  
Pfam View protein in Pfam  
PF01063  Aminotran_4  
CDD cd01557  BCAT_beta_family  
Amino Acid Sequences MTLETVSREPTSTIDWSQPIGFKYRHPRSHIKYIWTKETGWDKGELVRGNHTVTMDIAATALHYGQTCFEGMKAFRMKDGKIRIFRPELNAQRIQESCKAASMEAPPLPVFLDALRRVVEDNLDFVPPQGSNGSMYIRPFVFGSGPQLGLSPAPEFTFIILVNPVGPYYAGGMGSPVKALIAHSLDRAAPHGTGNTKLGGNYAPVFASTSVASAKGFTVNLFLDAATNTHIEEFATSNFAGCKRGADGKTIYVTPRSGSILKGVTNRSCAELASRHLGWNVERREISWDEVKDFDEVVATGTAVVMTPIGEIHREIKRPGKKVKVSADTGATTGAYDWDKDAEEEVGAEVDVQIVKFSKPPTEFRKLYDAVLDLQQGNLPGWQDYGWMWPAEGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.29
5 0.31
6 0.28
7 0.31
8 0.29
9 0.33
10 0.42
11 0.51
12 0.56
13 0.6
14 0.69
15 0.7
16 0.8
17 0.78
18 0.76
19 0.76
20 0.74
21 0.75
22 0.68
23 0.6
24 0.56
25 0.59
26 0.53
27 0.46
28 0.42
29 0.34
30 0.36
31 0.41
32 0.38
33 0.31
34 0.33
35 0.32
36 0.32
37 0.32
38 0.28
39 0.23
40 0.19
41 0.19
42 0.14
43 0.11
44 0.09
45 0.07
46 0.07
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.09
54 0.09
55 0.09
56 0.09
57 0.13
58 0.13
59 0.21
60 0.25
61 0.25
62 0.29
63 0.32
64 0.33
65 0.37
66 0.46
67 0.47
68 0.48
69 0.51
70 0.53
71 0.55
72 0.57
73 0.55
74 0.55
75 0.54
76 0.54
77 0.56
78 0.5
79 0.49
80 0.47
81 0.45
82 0.4
83 0.37
84 0.3
85 0.28
86 0.28
87 0.23
88 0.25
89 0.24
90 0.23
91 0.2
92 0.22
93 0.18
94 0.18
95 0.18
96 0.14
97 0.12
98 0.08
99 0.14
100 0.13
101 0.15
102 0.15
103 0.15
104 0.16
105 0.16
106 0.18
107 0.11
108 0.13
109 0.12
110 0.12
111 0.12
112 0.11
113 0.12
114 0.1
115 0.1
116 0.09
117 0.08
118 0.08
119 0.1
120 0.12
121 0.12
122 0.12
123 0.14
124 0.13
125 0.13
126 0.12
127 0.12
128 0.11
129 0.09
130 0.13
131 0.12
132 0.13
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.08
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.04
155 0.05
156 0.06
157 0.05
158 0.05
159 0.06
160 0.07
161 0.07
162 0.07
163 0.05
164 0.04
165 0.05
166 0.05
167 0.06
168 0.08
169 0.08
170 0.08
171 0.1
172 0.1
173 0.1
174 0.11
175 0.1
176 0.08
177 0.08
178 0.09
179 0.09
180 0.11
181 0.11
182 0.11
183 0.1
184 0.1
185 0.11
186 0.09
187 0.09
188 0.09
189 0.08
190 0.07
191 0.07
192 0.08
193 0.07
194 0.08
195 0.06
196 0.06
197 0.06
198 0.07
199 0.06
200 0.06
201 0.06
202 0.07
203 0.07
204 0.06
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.07
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.05
219 0.06
220 0.07
221 0.06
222 0.08
223 0.08
224 0.08
225 0.09
226 0.1
227 0.11
228 0.1
229 0.1
230 0.11
231 0.18
232 0.18
233 0.21
234 0.22
235 0.23
236 0.25
237 0.25
238 0.24
239 0.19
240 0.19
241 0.15
242 0.15
243 0.16
244 0.15
245 0.14
246 0.16
247 0.16
248 0.19
249 0.23
250 0.25
251 0.23
252 0.26
253 0.26
254 0.25
255 0.23
256 0.2
257 0.19
258 0.18
259 0.2
260 0.22
261 0.21
262 0.2
263 0.21
264 0.22
265 0.21
266 0.27
267 0.27
268 0.27
269 0.26
270 0.26
271 0.31
272 0.31
273 0.32
274 0.3
275 0.28
276 0.25
277 0.27
278 0.27
279 0.22
280 0.2
281 0.17
282 0.11
283 0.1
284 0.09
285 0.08
286 0.07
287 0.06
288 0.06
289 0.06
290 0.05
291 0.05
292 0.03
293 0.03
294 0.03
295 0.04
296 0.05
297 0.06
298 0.07
299 0.12
300 0.17
301 0.2
302 0.23
303 0.32
304 0.39
305 0.47
306 0.55
307 0.6
308 0.62
309 0.68
310 0.75
311 0.73
312 0.69
313 0.65
314 0.6
315 0.51
316 0.44
317 0.36
318 0.26
319 0.18
320 0.14
321 0.14
322 0.1
323 0.1
324 0.1
325 0.11
326 0.12
327 0.12
328 0.13
329 0.11
330 0.1
331 0.1
332 0.1
333 0.09
334 0.08
335 0.07
336 0.06
337 0.06
338 0.07
339 0.06
340 0.07
341 0.08
342 0.09
343 0.13
344 0.15
345 0.21
346 0.25
347 0.34
348 0.41
349 0.5
350 0.51
351 0.52
352 0.59
353 0.53
354 0.5
355 0.46
356 0.39
357 0.32
358 0.33
359 0.32
360 0.23
361 0.22
362 0.21
363 0.18
364 0.17
365 0.16
366 0.14
367 0.12
368 0.12
369 0.12
370 0.12
371 0.12
372 0.16
373 0.17
374 0.16