Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CNE3

Protein Details
Accession A0A1Y2CNE3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-108DSCPVFRKGRKRLHWSFPDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023485  Ptyr_pPase  
IPR036196  Ptyr_pPase_sf  
Pfam View protein in Pfam  
PF01451  LMWPc  
CDD cd16345  LMWP_ArsC  
Amino Acid Sequences METEKKTVLFLCTHNSARSQMAEGLLNKLAPETFAAQSAGTEETHVRPLALASMAELGMDISSHYSKTLDRFLDTEFDYVITVCDNANDSCPVFRKGRKRLHWSFPDPSKATGTEEEQKAFYGLVRDQIRERIEKELLVEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.31
5 0.3
6 0.26
7 0.22
8 0.21
9 0.24
10 0.22
11 0.23
12 0.21
13 0.2
14 0.17
15 0.16
16 0.14
17 0.1
18 0.11
19 0.11
20 0.11
21 0.12
22 0.13
23 0.12
24 0.12
25 0.13
26 0.12
27 0.09
28 0.09
29 0.09
30 0.1
31 0.13
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.09
38 0.08
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.03
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.09
55 0.14
56 0.13
57 0.13
58 0.14
59 0.15
60 0.17
61 0.17
62 0.15
63 0.1
64 0.1
65 0.09
66 0.08
67 0.08
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.08
75 0.09
76 0.09
77 0.11
78 0.13
79 0.16
80 0.19
81 0.25
82 0.33
83 0.42
84 0.52
85 0.59
86 0.66
87 0.71
88 0.77
89 0.8
90 0.77
91 0.76
92 0.72
93 0.71
94 0.63
95 0.57
96 0.5
97 0.42
98 0.39
99 0.33
100 0.32
101 0.32
102 0.32
103 0.32
104 0.29
105 0.29
106 0.26
107 0.23
108 0.19
109 0.15
110 0.13
111 0.2
112 0.22
113 0.24
114 0.26
115 0.33
116 0.35
117 0.36
118 0.37
119 0.35
120 0.35
121 0.33