Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2BC94

Protein Details
Accession A0A1Y2BC94    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-144QVQAQAQPKWPRRQVLRRRHHFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000315  Znf_B-box  
Gene Ontology GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50119  ZF_BBOX  
Amino Acid Sequences MSKSLAAILDADGNAMEDESTVTFAEQMRLEDEAALRGGSGAVGSGFCIECEDQPAVVHCNECGDNYCEVCHASQHRKGSRRLHTHHKLSRPSTGPSTGPVSQVPCLDSQLKYRLTNQGNPRQVQAQAQPKWPRRQVLRRRHHF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.04
5 0.06
6 0.06
7 0.07
8 0.06
9 0.06
10 0.08
11 0.09
12 0.11
13 0.11
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.13
20 0.11
21 0.11
22 0.09
23 0.08
24 0.07
25 0.06
26 0.05
27 0.05
28 0.03
29 0.03
30 0.03
31 0.03
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.09
39 0.1
40 0.09
41 0.09
42 0.11
43 0.11
44 0.11
45 0.11
46 0.08
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.12
53 0.12
54 0.12
55 0.11
56 0.11
57 0.11
58 0.11
59 0.13
60 0.17
61 0.22
62 0.29
63 0.34
64 0.39
65 0.46
66 0.52
67 0.57
68 0.61
69 0.62
70 0.65
71 0.68
72 0.72
73 0.72
74 0.71
75 0.69
76 0.62
77 0.64
78 0.57
79 0.52
80 0.45
81 0.42
82 0.34
83 0.3
84 0.32
85 0.26
86 0.25
87 0.23
88 0.22
89 0.21
90 0.21
91 0.2
92 0.15
93 0.17
94 0.18
95 0.18
96 0.2
97 0.25
98 0.28
99 0.29
100 0.31
101 0.38
102 0.4
103 0.46
104 0.51
105 0.55
106 0.58
107 0.57
108 0.56
109 0.5
110 0.48
111 0.45
112 0.44
113 0.44
114 0.41
115 0.49
116 0.57
117 0.62
118 0.7
119 0.71
120 0.72
121 0.72
122 0.79
123 0.8
124 0.82