Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2BNI9

Protein Details
Accession A0A1Y2BNI9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26LDTNEKRARRRASHNAVERRRRDBasic
NLS Segment(s)
PositionSequence
10-16RARRRAS
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences KNSLDTNEKRARRRASHNAVERRRRDIINEKIHELSQLLPDHHLLPADAQNKGSILRRSVDHMRGVQALAGRQAERITELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.77
4 0.81
5 0.83
6 0.83
7 0.85
8 0.78
9 0.73
10 0.68
11 0.58
12 0.55
13 0.54
14 0.55
15 0.55
16 0.55
17 0.51
18 0.48
19 0.47
20 0.41
21 0.31
22 0.23
23 0.17
24 0.16
25 0.14
26 0.13
27 0.14
28 0.14
29 0.14
30 0.13
31 0.08
32 0.08
33 0.13
34 0.14
35 0.14
36 0.14
37 0.14
38 0.14
39 0.16
40 0.2
41 0.17
42 0.16
43 0.18
44 0.19
45 0.25
46 0.3
47 0.33
48 0.32
49 0.31
50 0.32
51 0.31
52 0.3
53 0.26
54 0.22
55 0.19
56 0.18
57 0.19
58 0.17
59 0.17
60 0.17
61 0.16