Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2D297

Protein Details
Accession A0A1Y2D297    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
74-94HILPTTSKPKTKKGRKHNRRKBasic
NLS Segment(s)
PositionSequence
81-94KPKTKKGRKHNRRK
Subcellular Location(s) mito 18.5, mito_nucl 13.666, nucl 7.5, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MCPIKRVACIKKPSIKEYWPTFQEVFGSGVTCWSDDTTPMDYEALPRLIAAQSKQPTATKPIRSPTPEPLSTKHILPTTSKPKTKKGRKHNRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.62
4 0.61
5 0.61
6 0.54
7 0.53
8 0.48
9 0.42
10 0.38
11 0.31
12 0.25
13 0.17
14 0.16
15 0.1
16 0.11
17 0.11
18 0.1
19 0.09
20 0.08
21 0.08
22 0.08
23 0.11
24 0.12
25 0.12
26 0.12
27 0.12
28 0.11
29 0.12
30 0.13
31 0.11
32 0.08
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.14
39 0.15
40 0.16
41 0.17
42 0.18
43 0.18
44 0.25
45 0.31
46 0.3
47 0.33
48 0.38
49 0.42
50 0.47
51 0.49
52 0.51
53 0.52
54 0.5
55 0.49
56 0.47
57 0.47
58 0.44
59 0.41
60 0.37
61 0.32
62 0.29
63 0.31
64 0.37
65 0.41
66 0.48
67 0.54
68 0.54
69 0.62
70 0.71
71 0.78
72 0.79
73 0.8
74 0.82