Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CDK1

Protein Details
Accession A0A1Y2CDK1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-134ATRQPHNITTNKRKPPKKVRAEATKSMSTHydrophilic
NLS Segment(s)
PositionSequence
117-139KRKPPKKVRAEATKSMSTRRVKP
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MEPYYPHVSNVSGYYPHAVVLRCSSCGVSSSNHWTRGVHDERLCSNCAQNLNPEPFKPIHSSDPRYSVVPDEKRMSPVHPSYPPMQPVDSLKSPERVNLDPKLFSATRQPHNITTNKRKPPKKVRAEATKSMSTRRVKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.18
4 0.19
5 0.17
6 0.16
7 0.21
8 0.22
9 0.2
10 0.21
11 0.2
12 0.18
13 0.19
14 0.19
15 0.15
16 0.17
17 0.26
18 0.3
19 0.32
20 0.32
21 0.31
22 0.32
23 0.39
24 0.39
25 0.36
26 0.33
27 0.33
28 0.36
29 0.39
30 0.37
31 0.29
32 0.26
33 0.22
34 0.23
35 0.2
36 0.22
37 0.24
38 0.28
39 0.29
40 0.28
41 0.28
42 0.26
43 0.28
44 0.26
45 0.24
46 0.26
47 0.31
48 0.36
49 0.35
50 0.39
51 0.38
52 0.35
53 0.33
54 0.28
55 0.29
56 0.26
57 0.27
58 0.25
59 0.25
60 0.27
61 0.27
62 0.25
63 0.24
64 0.24
65 0.26
66 0.24
67 0.26
68 0.27
69 0.3
70 0.31
71 0.27
72 0.25
73 0.21
74 0.22
75 0.25
76 0.24
77 0.24
78 0.23
79 0.26
80 0.26
81 0.28
82 0.29
83 0.26
84 0.29
85 0.32
86 0.33
87 0.29
88 0.29
89 0.32
90 0.28
91 0.26
92 0.31
93 0.32
94 0.36
95 0.41
96 0.44
97 0.43
98 0.5
99 0.56
100 0.56
101 0.6
102 0.64
103 0.68
104 0.75
105 0.77
106 0.81
107 0.86
108 0.87
109 0.86
110 0.86
111 0.86
112 0.88
113 0.89
114 0.87
115 0.82
116 0.79
117 0.7
118 0.66
119 0.64