Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2CHB0

Protein Details
Accession A0A1Y2CHB0    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
57-93LTGFRKRKLEESRRPRREMPNWRRKLYEKQGRKRETKBasic
NLS Segment(s)
PositionSequence
6-40KGKDKKAGAGGNRKGKGKKGEKVKPYSFKPKKDAK
61-93RKRKLEESRRPRREMPNWRRKLYEKQGRKRETK
Subcellular Location(s) nucl 21, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MGANQKGKDKKAGAGGNRKGKGKKGEKVKPYSFKPKKDAKERDELISYDDASRSDYLTGFRKRKLEESRRPRREMPNWRRKLYEKQGRKRETK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.65
4 0.67
5 0.68
6 0.61
7 0.61
8 0.63
9 0.61
10 0.6
11 0.61
12 0.66
13 0.69
14 0.76
15 0.77
16 0.75
17 0.73
18 0.77
19 0.74
20 0.72
21 0.71
22 0.71
23 0.71
24 0.74
25 0.76
26 0.69
27 0.71
28 0.67
29 0.62
30 0.55
31 0.46
32 0.38
33 0.29
34 0.25
35 0.15
36 0.14
37 0.11
38 0.1
39 0.1
40 0.09
41 0.08
42 0.08
43 0.11
44 0.18
45 0.26
46 0.27
47 0.31
48 0.35
49 0.37
50 0.45
51 0.53
52 0.57
53 0.59
54 0.67
55 0.75
56 0.79
57 0.83
58 0.8
59 0.8
60 0.79
61 0.8
62 0.8
63 0.8
64 0.81
65 0.78
66 0.77
67 0.73
68 0.73
69 0.73
70 0.73
71 0.72
72 0.75
73 0.82