Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2CB96

Protein Details
Accession A0A1Y2CB96   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-45FDTTDSKRGWRKKKASQVDVRVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR046985  IP5  
Gene Ontology GO:0046856  P:phosphatidylinositol dephosphorylation  
Amino Acid Sequences MKSGKVLYGFQEHPISFPPTYKFDTTDSKRGWRKKKASQVDVRVDEPVNVYDTSKKSRIPSWTDRILWREKLGANKNRRVTCEEYGCELGAQGSDHKPVYALFDVSMSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.25
4 0.27
5 0.27
6 0.26
7 0.3
8 0.3
9 0.29
10 0.29
11 0.38
12 0.41
13 0.46
14 0.45
15 0.49
16 0.56
17 0.63
18 0.68
19 0.69
20 0.71
21 0.72
22 0.8
23 0.81
24 0.82
25 0.82
26 0.81
27 0.79
28 0.73
29 0.64
30 0.56
31 0.46
32 0.36
33 0.28
34 0.2
35 0.14
36 0.11
37 0.11
38 0.13
39 0.15
40 0.18
41 0.19
42 0.2
43 0.2
44 0.24
45 0.29
46 0.33
47 0.38
48 0.41
49 0.45
50 0.45
51 0.46
52 0.46
53 0.46
54 0.4
55 0.33
56 0.3
57 0.27
58 0.33
59 0.4
60 0.44
61 0.47
62 0.53
63 0.6
64 0.6
65 0.6
66 0.57
67 0.54
68 0.53
69 0.52
70 0.46
71 0.42
72 0.41
73 0.38
74 0.32
75 0.26
76 0.2
77 0.13
78 0.12
79 0.11
80 0.12
81 0.15
82 0.15
83 0.15
84 0.15
85 0.15
86 0.2
87 0.19
88 0.18
89 0.15